DNA polymerase sliding clamp from Escherichia coli with peptide 43 bound. Determined by X-ray diffraction at 1.61 Å resolution. Released 1 Dec 2021.
Explore 7AZ8 in 3D Show helices and sheets RCSB PDB PDBe
7AZ8 contains 34 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| α-helix | 7-17 | 11 | |
| α-helix | 28-31 | 4 | |
| β-strand | 32-38 | 7 | 2 |
| β-strand | 41-47 | 7 | 2 |
| β-strand | 51-58 | 8 | 2 |
| β-strand | 64 | 1 | 1 |
| β-strand | 66-71 | 6 | 2 |
| α-helix | 72-81 | 10 | |
| α-helix | 83 | 1 | |
| β-strand | 87-93 | 7 | 1 |
| β-strand | 96-101 | 6 | 1 |
| β-strand | 104-109 | 6 | 1 |
| β-strand | 111 | 1 | 2 |
| α-helix | 113-115 | 3 | |
| α-helix | 119-121 | 3 | |
| β-strand | 126-130 | 5 | 2 |
| α-helix | 132-142 | 11 | |
| α-helix | 143-145 | 3 | |
| α-helix | 153-155 | 3 | |
| β-strand | 157-172 | 16 | 3 |
| β-strand | 176-196 | 21 | 3 |
| α-helix | 197-206 | 10 | |
| α-helix | 212-213 | 2 | |
| β-strand | 214-218 | 5 | 2 |
| β-strand | 222-227 | 6 | 2 |
| β-strand | 230-235 | 6 | 2 |
| α-helix | 236 | 1 | |
| β-strand | 237 | 1 | 3 |
| α-helix | 244-247 | 4 | |
| α-helix | 249 | 1 | |
| β-strand | 254-259 | 6 | 3 |
| α-helix | 260-271 | 12 | |
| β-strand | 280-286 | 7 | 4 |
| β-strand | 289-295 | 7 | 4 |
| β-strand | 301-307 | 7 | 4 |
| β-strand | 309 | 1 | 3 |
| β-strand | 315-320 | 6 | 4 |
| α-helix | 321-331 | 11 | |
| β-strand | 335-340 | 6 | 3 |
| β-strand | 347-351 | 5 | 3 |
| β-strand | 357-361 | 5 | 3 |
| β-strand | 364 | 1 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 4 |
| α-helix | 7-17 | 11 | |
| α-helix | 28-31 | 4 | |
| β-strand | 32-38 | 7 | 5 |
| β-strand | 41-47 | 7 | 5 |
| β-strand | 51-58 | 8 | 5 |
| β-strand | 64 | 1 | 4 |
| β-strand | 66-71 | 6 | 5 |
| α-helix | 72-81 | 10 | |
| α-helix | 83 | 1 | |
| β-strand | 87-93 | 7 | 4 |
| β-strand | 96-101 | 6 | 4 |
| β-strand | 104-109 | 6 | 4 |
| β-strand | 111 | 1 | 5 |
| α-helix | 113-115 | 3 | |
| α-helix | 119-121 | 3 | |
| β-strand | 124-131 | 8 | 5 |
| α-helix | 132-142 | 11 | |
| α-helix | 143-145 | 3 | |
| α-helix | 153-155 | 3 | |
| β-strand | 157-172 | 16 | 6 |
| β-strand | 176-196 | 21 | 6 |
| α-helix | 197-206 | 10 | |
| α-helix | 212 | 1 | |
| β-strand | 213-219 | 7 | 5 |
| β-strand | 222-227 | 6 | 5 |
| β-strand | 230-235 | 6 | 5 |
| α-helix | 236-238 | 3 | |
| α-helix | 244-247 | 4 | |
| α-helix | 249 | 1 | |
| β-strand | 254-259 | 6 | 6 |
| α-helix | 260-271 | 12 | |
| β-strand | 280-286 | 7 | 1 |
| β-strand | 289-295 | 7 | 1 |
| β-strand | 301-307 | 7 | 1 |
| β-strand | 309 | 1 | 6 |
| β-strand | 315-320 | 6 | 1 |
| α-helix | 321-331 | 11 | |
| β-strand | 335-340 | 6 | 6 |
| β-strand | 347-351 | 5 | 6 |
| β-strand | 357-361 | 5 | 6 |
| β-strand | 364 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 103-105 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta sliding clamp | A, B | protein | 386 | Escherichia coli 2-427-07_S4_C3 | P0A988 (AlphaFold model) |
| Peptide 43 | H, I | protein | 7 | synthetic construct |
>7AZ8_1 Beta sliding clamp (chains A, B) MGSSHHHHHHSSGLVPRGSHMKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADG TLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVR SGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLF ETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGS NNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRG VRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMML TDSVSSVQIEDAASQSAAYVVMPMRL
>7AZ8_2 Peptide 43 (chains H, I) XQADLPL
Iterative Structure-Based Optimization of Short Peptides Targeting the Bacterial Sliding Clamp. Monsarrat, C., Compain, G., Andre, C. et al. J Med Chem (2021) 64:17063-17078. DOI 10.1021/acs.jmedchem.1c00918 · PubMed
Other PDB entries of the same protein (UniProt P0A988 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7AZ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.