7B00: Human LAT2-4F2hc complex in the apo-state

Human LAT2-4F2hc complex in the apo-state. Determined by electron microscopy at 3.98 Å resolution. Released 27 Oct 2021.

Method: Electron microscopy
Resolution: 3.98 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,389
Mol. weight: 119.35 kDa
Ligands: AJP
Released: 27 Oct 2021

Explore 7B00 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B00 contains 51 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	47-53	7
α-helix	64-67	4
α-helix	78-99	22
α-helix	107-111	5
α-helix	116-125	10
α-helix	140-147	8
α-helix	155-157	3
α-helix	158-160	3
α-helix	162-177	16
α-helix	182-185	4
α-helix	187-189	3
α-helix	192-211	20
α-helix	256-259	4
α-helix	273-288	16
α-helix	302-308	7
α-helix	320-323	4
α-helix	338-344	7
β-strand	357	1	1
α-helix	365-376	12
α-helix	377-379	3
α-helix	385-395	11
α-helix	398-411	14
α-helix	426-433	8
α-helix	435-438	4
α-helix	440-443	4
α-helix	452-455	4
α-helix	459-462	4
α-helix	477-490	14
β-strand	494	1	1

Chain B: 24 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	66-72	7
α-helix	75-105	31
α-helix	107-108	2
α-helix	110-112	3
α-helix	117-119	3
β-strand	123-125	3	2
α-helix	129-133	5
α-helix	140-145	6
α-helix	147-150	4
β-strand	159-160	2	2
α-helix	161-162	2
β-strand	165-166	2	3
β-strand	174-175	2	3
α-helix	186-196	11
β-strand	204-206	3	2
α-helix	224-227	4
α-helix	229-238	10
β-strand	244-247	4	2
α-helix	249-251	3
α-helix	255-269	15
β-strand	275-278	4	2
α-helix	284-290	7
β-strand	298-300	3	2
α-helix	311-325	15
α-helix	346-348	3
α-helix	349-356	8
β-strand	364-366	3	2
α-helix	386-388	3
α-helix	404-406	3
α-helix	408-411	4
α-helix	419-426	8
α-helix	434-437	4
β-strand	439-442	4	4
β-strand	449-455	7	4
β-strand	461-467	7	4
β-strand	473	1	5
β-strand	491-497	7	4
β-strand	507-509	3	4
β-strand	515	1	5
α-helix	516	1
β-strand	519-525	7	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Large neutral amino acids transporter small subunit 2	A	protein	535	Homo sapiens	Q9UHI5 (AlphaFold model)
Isoform 2 of 4F2 cell-surface antigen heavy chain	B	protein	529	Homo sapiens	P08195 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7B00_1 Large neutral amino acids transporter small subunit 2 (chains A)
MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFV
SPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGF
LRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSV
RWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQ
GSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELLASN
AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVK
RCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPI
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFI
ELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

Sequence of entity 2 (B), FASTA

>7B00_2 Isoform 2 of 4F2 cell-surface antigen heavy chain (chains B)
MSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKF
TGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHT
GALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQID
PNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAG
VDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLT
SSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLP
GTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLS
LFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQAS
DLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA

Ligands and cofactors

ID	Name	Formula	Copies
AJP	Digitonin	C56 H92 O29	1

Primary citation

Structural basis for substrate specificity of heteromeric transporters of neutral amino acids. Rodriguez, C.F., Escudero-Bravo, P., Diaz, L. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2113573118 · PubMed

Other PDB entries of the same protein (UniProt Q9UHI5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
8A6L 3.18 Å, Human 4F2hc-LAT2 heterodimeric amino acid transporter in complex with anticalin D11vs
7CMH 3.4 Å, The LAT2-4F2hc complex in complex with tryptophan

Browse structure collections

About this viewer

MolViewer shows 7B00 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.