Complement inhibitor CirpA1 from Rhipicephalus pulchellus. Determined by X-ray diffraction at 1.96 Å resolution. Released 8 Dec 2021.
Explore 7B2D in 3D Show helices and sheets RCSB PDB PDBe
7B2D contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 52-55 | 4 | |
| β-strand | 60-66 | 7 | 1 |
| α-helix | 71-72 | 2 | |
| β-strand | 73-82 | 10 | 1 |
| β-strand | 86-95 | 10 | 1 |
| β-strand | 98-109 | 12 | 1 |
| β-strand | 120-123 | 4 | 1 |
| β-strand | 130-138 | 9 | 1 |
| β-strand | 144-153 | 10 | 1 |
| β-strand | 156-165 | 10 | 1 |
| α-helix | 174-176 | 3 | |
| α-helix | 177-190 | 14 | |
| β-strand | 195 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CirpA1 | A | protein | 180 | Rhipicephalus pulchellus | A0A8X6EGU0 (AlphaFold model) |
>7B2D_1 CirpA1 (chains A) GPMGEDQETDFSSTDGAELIAKEPEVYPIDQFMNNTEIWVFNTTQPDPPNCKKDKSKSMT QTATSFVRSHVKNGNIIEENLVGNFTYFNDKEKVYDGIYISGESSGVYAEHLYYVSEDKK CGLFQVFAHVNDKTTIWRDVRVSGRPEEGVPLELNCTKEFDEYVKLVNATSKSPYTSECQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| MLT | D-malate | C4 H6 O5 | 2 |
Structure and function of a family of tick-derived complement inhibitors targeting properdin. Braunger, K., Ahn, J., Jore, M.M. et al. Nat Commun (2022) 13:317-317. DOI 10.1038/s41467-021-27920-2 · PubMed
Other PDB entries of the same protein (UniProt A0A8X6EGU0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7B2D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.