7BGF: DNA endonuclease RBBP8,CtIP/RBBP8

Crystal structure of the N-terminal dimeric coiled coil of the human ctip protein. Determined by X-ray diffraction at 2.8 Å resolution. Released 30 Jun 2021.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,911
Mol. weight: 30.55 kDa
Released: 30 Jun 2021

Explore 7BGF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BGF contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	31-140	110

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	32-137	106

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA endonuclease RBBP8,CtIP/RBBP8	A, B	protein	127	Homo sapiens	Q99708 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7BGF_1 DNA endonuclease RBBP8,CtIP/RBBP8 (chains A, B)
GSMGHDREVQGLQVKVTKLKQERILDAQRLEEFFTKNQQLREQQKVLHETIKVLEDRLRA
GLADRAAVTEEHMRKKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQKIENDW
SHPQFEK

Primary citation

Structural basis for the coiled-coil architecture of human CtIP. Morton, C.R., Rzechorzek, N.J., Maman, J.D. et al. Open Biol (2021) 11:210060-210060. DOI 10.1098/rsob.210060 · PubMed

Other PDB entries of the same protein (UniProt Q99708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4D2H 1.9 Å, Crystal structure of the tetramerisation domain of human CtIP
1Y98 2.5 Å, Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.

Browse structure collections

About this viewer

MolViewer shows 7BGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.