7BJG: Atypical Tm1 (Tm1-I/C), residues 262-363

Crystal structure of atypical Tm1 (Tm1-I/C), residues 262-363. Determined by X-ray diffraction at 2.45 Å resolution. Released 26 May 2021.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 816
Mol. weight: 11.92 kDa
Released: 26 May 2021

Explore 7BJG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BJG contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	263-354	92

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SD21996p	A	protein	103	Drosophila melanogaster	Q8IGY1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7BJG_1 SD21996p (chains A)
SMKFNIIRNELHNIMNTQLKRAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQA
ADESERARKILENRALADEERMDALENQLKEARFLAEEADKKY

Primary citation

Molecular basis of mRNA transport by a kinesin-1-atypical tropomyosin complex. Dimitrova-Paternoga, L., Jagtap, P.K.A., Cyrklaff, A. et al. Genes Dev (2021) 35:976-991. DOI 10.1101/gad.348443.121 · PubMed

Other PDB entries of the same protein (UniProt Q8IGY1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BJS 2.28 Å, Crystal structure of Khc/atypical Tm1 complex
7BJN 2.3 Å, Crystal structure of atypical Tm1 (Tm1-I/C), residues 270-334

Browse structure collections

About this viewer

MolViewer shows 7BJG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.