7BLR: Vacuolar protein sorting-associated protein 35

Vps35/Vps29 arch of fungal membrane-assembled retromer:Vps5 (SNX-BAR) complex. Determined by electron microscopy at 9.3 Å resolution. Released 10 Feb 2021.

Method: Electron microscopy
Resolution: 9.3 Å
Organism: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Chains: 4
Atoms: 14,950
Mol. weight: 241.79 kDa
Released: 10 Feb 2021

Explore 7BLR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BLR contains 95 α-helices and 35 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 42 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	13-32	20
α-helix	38-53	16
α-helix	59-83	25
α-helix	92-95	4
α-helix	103-119	17
α-helix	124-134	11
α-helix	135-137	3
α-helix	141-155	15
α-helix	171-191	21
α-helix	198-200	3
α-helix	201-222	22
α-helix	228-236	9
α-helix	238-246	9
α-helix	249-262	14
α-helix	266-279	14
α-helix	288-303	16
α-helix	389-403	15
α-helix	408-425	18
α-helix	430-435	6
α-helix	436-442	7
α-helix	443-447	5
α-helix	458-470	13
α-helix	477-480	4
α-helix	483-486	4
α-helix	487-491	5
α-helix	494-510	17
α-helix	519-531	13
α-helix	561-572	12
α-helix	577-590	14
α-helix	598-600	3
α-helix	602-617	16
α-helix	620-622	3
α-helix	626-645	20
α-helix	654-670	17
α-helix	677-690	14
α-helix	695-710	16
α-helix	720-732	13
α-helix	737-746	10
β-strand	752	1	1
β-strand	760	1	2
β-strand	766	1	2
β-strand	769	1	1
α-helix	772-785	14
α-helix	791-810	20
α-helix	818-835	18
α-helix	840-855	16

Chain B: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	3
β-strand	13	1	4
α-helix	22-26	5
β-strand	43	1	4
α-helix	45-54	10
β-strand	78	1	5
β-strand	85-87	3	5
α-helix	98-108	11
β-strand	112-114	3	5
β-strand	122-123	2	6
β-strand	126-127	2	7
β-strand	130-131	2	7
β-strand	133	1	5
β-strand	134-135	2	6
β-strand	157-163	7	3
β-strand	166-176	11	3
β-strand	182-192	11	3

Chain C: 47 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	38-52	15
α-helix	59-83	25
α-helix	84-86	3
α-helix	92-95	4
α-helix	102-119	18
α-helix	124-134	11
α-helix	135-137	3
α-helix	141-155	15
α-helix	156-158	3
α-helix	171-191	21
α-helix	201-222	22
α-helix	228-234	7
α-helix	236-246	11
α-helix	249-250	2
α-helix	251-255	5
α-helix	256-262	7
α-helix	267-269	3
α-helix	273-279	7
α-helix	288-303	16
α-helix	389-403	15
α-helix	408-425	18
α-helix	431-434	4
α-helix	435-442	8
α-helix	443-447	5
α-helix	457-472	16
α-helix	477-480	4
α-helix	485-491	7
α-helix	494-509	16
α-helix	518-531	14
α-helix	562-574	13
α-helix	580-590	11
α-helix	602-617	16
α-helix	625-645	21
α-helix	655-670	16
α-helix	674-691	18
α-helix	695-710	16
α-helix	717-732	16
α-helix	737-747	11
α-helix	748-750	3
α-helix	756-758	3
β-strand	759	1	8
α-helix	761-763	3
β-strand	767	1	8
α-helix	771-785	15
α-helix	791-810	20
α-helix	818-834	17
α-helix	836-837	2
α-helix	840-855	16

Chain D: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	9
α-helix	22-27	6
α-helix	45-54	10
β-strand	76-80	5	10
β-strand	83-87	5	10
α-helix	98-108	11
β-strand	126-127	2	11
β-strand	130-131	2	11
β-strand	137	1	12
β-strand	155	1	12
β-strand	157-158	2	13
β-strand	160	1	9
β-strand	162-163	2	14
β-strand	166-167	2	14
β-strand	171-172	2	13
β-strand	174-175	2	15
β-strand	183-184	2	15
β-strand	191-192	2	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vacuolar protein sorting-associated protein 35	A, C	protein	869	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S709 (AlphaFold model)
Vacuolar protein sorting-associated protein 29	B, D	protein	202	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZB5 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7BLR_1 Vacuolar protein sorting-associated protein 35 (chains A, C)
MSTPAPPEEQARLLEDALIAVRQQTAMMRKFLDTPGKLMDALKCCSTLVSELRTSSLSPK
QYYELYMAVFDALRYLSAHLRENHPVNHLADLYELVQYAGNIIPRLYLMITVGTAYMSID
GAPVKELMKDMMDMSRGVQHPVRGLFLRYYLSGQARDYLPTGDSDGPEGNLQDSINFILT
NFVEMNKLWVRLQHQGHSRERDLRTQERRELQLLVGSNIVRLSQLVDLPTYRDSILGPLL
EQIVQCRDILAQEYLLEVITQVFPDEYHLHTLDQFLGAVSRLNPHVNVKAIVIGMMNRLS
DYAERESQNEPEEDRAKLEEEALAKLLEKTKLGQNSELEPQNGDHPDTEVSSTTDSAQAP
STADSDTTAVNGEEEPVRKRRGIPVNVPLYDIFFDQVQHLVQAQHLPIQDTIALCCSLAN
LSLNIYPERLDYVDGILAYALAKVKEHANSADLHSQPAQQSLLSLLQSPLRRYVSIFTAL
SLPTYVSLFQAQTYPTRRAIAGEIVRTLLKNQTLISTPAHLENVLEILKVLIKEGSQPPA
GYPGVVQPRARPLETDETMEEQGWLARLVHLIHSDDNDTQFRLLQMTRKAYAEGNERIRT
TTPPLITAGLKLARRFKAREHYDDNWSSQSSSLFKFLHSAISTLYTRVNGPGVADLCLRL
FCSCGQVADMTEFEEVAYEFFAQAFTVYEESISDSKAQFQAVCVIASALHRTRNFGRENY
DTLITKCAQHASKLLRKPDQCRAVYLASHLWWATPIAARGETEDTELYRDGKRVLECLQR
ALRVADSCMETATSIELFVEILDRYVYYFDQRNESVTTKYLNGLIELIHSNLAGNQQDSA
SVEASRKHFIQTLEMIQSKEFEGIVVAPK

Sequence of entity 2 (B, D), FASTA

>7BLR_2 Vacuolar protein sorting-associated protein 29 (chains B, D)
SMAFLILVIGNLHIPDRALDIPPKFKKLLSPGKISQTLCLGNLTDRATYDYLRSISPDLK
IVRGRMDVEATSLPLMQVVTHGSLRIGFLEGFTLVSEEPDVLLAEANKLDVDVLCWAGGS
HRFECFEYMDKFFVNPGSATGAFTTDWLAEGEEVVPSFCLMDVQGISLTLYVYQLRKDEN
GTENVAVEKVTYTKPVEPTGAS

Primary citation

Architecture and mechanism of metazoan retromer:SNX3 tubular coat assembly. Leneva, N., Kovtun, O., Morado, D.R. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abf8598 · PubMed

Other PDB entries of the same protein (UniProt G0S709 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BLQ 9.2 Å, Vps26 dimer region of the fungal membrane-assembled retromer:Grd19 complex.
7BLP 9.5 Å, Vps35/Vps29 arch of fungal membrane-assembled retromer:Grd19 complex
6H7W 11.4 Å, Model of retromer-Vps5 complex assembled on membrane.

Browse structure collections

About this viewer

MolViewer shows 7BLR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.