7BT6: 60S ribosomal protein L2-A
Cryo-EM structure of pre-60S ribosome from Saccharomyces cerevisiae rpl4delta63-87 strain at 3.12 Angstroms resolution(state R1). Determined by electron microscopy at 3.12 Å resolution. Released 28 Oct 2020.
- Method
- Electron microscopy
- Resolution
- 3.12 Å
- Organisms
- Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 47
- Atoms
- 133,299
- Mol. weight
- 2215.43 kDa
- Ligands
- GTP, MG, ZN
- Released
- 28 Oct 2020
Explore 7BT6 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7BT6 contains 315 α-helices and 381 β-strands across 44 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 2 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 72-73 | 2 | 113 |
| α-helix | 84-91 | 8 | |
| β-strand | 99-100 | 2 | 42 |
| β-strand | 101-103 | 3 | 114 |
| β-strand | 111-112 | 2 | 113 |
| β-strand | 124-127 | 4 | 114 |
| β-strand | 129-130 | 2 | 113 |
| α-helix | 132-141 | 10 | |
| β-strand | 144-147 | 4 | 114 |
Chain A: 5 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 29-32 | 4 | |
| α-helix | 34-38 | 5 | |
| β-strand | 42-49 | 8 | 1 |
| β-strand | 58-63 | 6 | 1 |
| β-strand | 72-77 | 6 | 1 |
| β-strand | 79 | 1 | 2 |
| β-strand | 83 | 1 | 3 |
| β-strand | 87-89 | 3 | 1 |
| β-strand | 101-103 | 3 | 4 |
| α-helix | 104-106 | 3 | |
| β-strand | 112-114 | 3 | 4 |
| β-strand | 134-140 | 7 | 4 |
| β-strand | 145-149 | 5 | 4 |
| β-strand | 155-159 | 5 | 4 |
| β-strand | 163-166 | 4 | 4 |
| β-strand | 169 | 1 | 2 |
| α-helix | 174-176 | 3 | |
| α-helix | 182-189 | 8 | |
Chain b: 19 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-27 | 14 | |
| α-helix | 39-65 | 27 | |
| α-helix | 78-86 | 9 | |
| α-helix | 88-116 | 29 | |
| α-helix | 122-140 | 19 | |
| α-helix | 146-157 | 12 | |
| β-strand | 169-173 | 5 | 115 |
| α-helix | 180-187 | 8 | |
| β-strand | 205-211 | 7 | 115 |
| β-strand | 214-220 | 7 | 115 |
| α-helix | 236-245 | 10 | |
| β-strand | 248-252 | 5 | 115 |
| β-strand | 253-254 | 2 | 116 |
| α-helix | 264-274 | 11 | |
| α-helix | 275-278 | 4 | |
| β-strand | 284-287 | 4 | 116 |
| α-helix | 295-297 | 3 | |
| α-helix | 300-307 | 8 | |
| β-strand | 316-319 | 4 | 116 |
| α-helix | 328-349 | 22 | |
| α-helix | 353-357 | 5 | |
| β-strand | 364 | 1 | 117 |
| α-helix | 380-383 | 4 | |
| α-helix | 400-406 | 7 | |
| β-strand | 435 | 1 | 118 |
| β-strand | 440 | 1 | 118 |
| α-helix | 441-444 | 4 | |
| α-helix | 450-466 | 17 | |
| α-helix | 487-511 | 25 | |
Chain B: 11 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 43 | 1 | 6 |
| β-strand | 47-59 | 13 | 7 |
| β-strand | 71-80 | 10 | 7 |
| β-strand | 84-96 | 13 | 8 |
| β-strand | 98-106 | 9 | 8 |
| α-helix | 112-115 | 4 | |
| α-helix | 116-118 | 3 | |
| α-helix | 131-134 | 4 | |
| α-helix | 135-137 | 3 | |
| α-helix | 145-153 | 9 | |
| β-strand | 157-163 | 7 | 8 |
| α-helix | 166-168 | 3 | |
| β-strand | 178-182 | 5 | 8 |
| β-strand | 183 | 1 | 6 |
| α-helix | 188-197 | 10 | |
| β-strand | 202-203 | 2 | 8 |
| α-helix | 205-207 | 3 | |
| β-strand | 214-221 | 8 | 7 |
| β-strand | 225-227 | 3 | 9 |
| α-helix | 229-233 | 5 | |
| α-helix | 235-238 | 4 | |
| β-strand | 242 | 1 | 10 |
| β-strand | 245 | 1 | 10 |
| β-strand | 268-270 | 3 | 9 |
| β-strand | 273-285 | 13 | 7 |
| β-strand | 321-325 | 5 | 7 |
| β-strand | 335-339 | 5 | 7 |
| β-strand | 356-359 | 4 | 7 |
| α-helix | 373-380 | 8 | |
Chain c: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-19 | 10 | |
| β-strand | 21-25 | 5 | 5 |
| α-helix | 27-36 | 10 | |
| β-strand | 41-44 | 4 | 5 |
| α-helix | 50-62 | 13 | |
| β-strand | 66-69 | 4 | 5 |
| α-helix | 74-80 | 7 | |
| β-strand | 89-95 | 7 | 5 |
Chain C: 20 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-6 | 2 | 12 |
| β-strand | 9 | 1 | 13 |
| β-strand | 20-21 | 2 | 12 |
| α-helix | 25-27 | 3 | |
| α-helix | 32-42 | 11 | |
| α-helix | 98-99 | 2 | |
| α-helix | 115-127 | 13 | |
| α-helix | 134-137 | 4 | |
| β-strand | 150-152 | 3 | 13 |
| α-helix | 154-158 | 5 | |
| α-helix | 162-170 | 9 | |
| α-helix | 175-180 | 6 | |
| β-strand | 186-187 | 2 | 14 |
| α-helix | 193-195 | 3 | |
| β-strand | 199-200 | 2 | 14 |
| β-strand | 206-209 | 4 | 13 |
| β-strand | 226-229 | 4 | 13 |
| α-helix | 235-238 | 4 | |
| α-helix | 240-242 | 3 | |
| β-strand | 248-251 | 4 | 13 |
| α-helix | 254-262 | 9 | |
| α-helix | 286-291 | 6 | |
| α-helix | 293-298 | 6 | |
| α-helix | 300-301 | 2 | |
| α-helix | 307-309 | 3 | |
| α-helix | 321-326 | 6 | |
| α-helix | 331-334 | 4 | |
| α-helix | 350-352 | 3 | |
| α-helix | 353-360 | 8 | |
Chain d: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-15 | 8 | 11 |
| α-helix | 25-27 | 3 | |
| α-helix | 29-44 | 16 | |
| β-strand | 49-51 | 3 | 11 |
| α-helix | 53-59 | 7 | |
| β-strand | 70-79 | 10 | 11 |
| β-strand | 89-95 | 7 | 11 |
| β-strand | 108 | 1 | 11 |
Chain D: 14 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-15 | 6 | |
| α-helix | 21-24 | 4 | |
| α-helix | 30-37 | 8 | |
| β-strand | 50-56 | 7 | 16 |
| β-strand | 59-66 | 8 | 16 |
| β-strand | 73-79 | 7 | 16 |
| α-helix | 80-85 | 6 | |
| α-helix | 95-112 | 18 | |
| α-helix | 141-142 | 2 | |
| β-strand | 143 | 1 | 17 |
| β-strand | 146-147 | 2 | 16 |
| α-helix | 160-169 | 10 | |
| β-strand | 172 | 1 | 17 |
| β-strand | 184 | 1 | 18 |
| β-strand | 189 | 1 | 18 |
| α-helix | 192-199 | 8 | |
| α-helix | 202-214 | 13 | |
| α-helix | 217-220 | 4 | |
| α-helix | 224-227 | 4 | |
| α-helix | 235-249 | 15 | |
| α-helix | 262-269 | 8 | |
| α-helix | 279-291 | 13 | |
36 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 60S ribosomal protein L2-A | A | protein | 254 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P0CX45 (AlphaFold model) |
| 60S ribosomal protein L3 | B | protein | 387 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P14126 (AlphaFold model) |
| 60S ribosomal protein L4-A | C | protein | 362 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P10664 (AlphaFold model) |
| 60S ribosomal protein L5 | D | protein | 297 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P26321 (AlphaFold model) |
| 60S ribosomal protein L6-A | E | protein | 176 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | Q02326 |
| 60S ribosomal protein L7-A | F | protein | 244 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P05737 |
| 60S ribosomal protein L8-A | G | protein | 256 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P17076 |
| 60S ribosomal protein L9-A | H | protein | 191 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P05738 |
| 60S ribosomal protein L11-A | J | protein | 174 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P0C0W9 |
| 60S ribosomal protein L13-A | L | protein | 199 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | Q12690 |
| 60S ribosomal protein L14-A | M | protein | 138 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P36105 |
| 60S ribosomal protein L15-A | N | protein | 204 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P05748 |
35 more molecules are not listed.
Sequence of entity 1 (A), FASTA
>7BT6_1 60S ribosomal protein L2-A (chains A)
MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAK
VVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKP
GDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLL
KAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAA
RRTGLLRGSQKTQD
Sequence of entity 2 (B), FASTA
>7BT6_2 60S ribosomal protein L3 (chains B)
MSHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDL
DRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYK
NWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVLVHTQIRKTPLAQKKAHLAE
IQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPR
KTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDR
TKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWID
TASKFGKGRFQTPAEKHAFMGTLKKDL
Sequence of entity 3 (C), FASTA
>7BT6_3 60S ribosomal protein L4-A (chains C)
MSRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAVSEKAGHQT
SAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFAPTKTWRKWNVKVNHNEKRY
ATASAIAATAVASLVLARGHRVEKIPEIPLVVSTDLESIQKTKEAVAALKAVGAHSDLLK
VLKSKKLRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAP
GAHLGRFVIWTEAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIR
PAGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPAAVFTETLK
HD
Sequence of entity 4 (D), FASTA
>7BT6_4 60S ribosomal protein L5 (chains D)
MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI
ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK
GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY
TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Sequence of entity 5 (E), FASTA
>7BT6_5 60S ribosomal protein L6-A (chains E)
MSAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLED
NTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYFAKEKLTKKEKKEAN
LFPEQQNKEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDKPHMLKF
Sequence of entity 6 (F), FASTA
>7BT6_6 60S ribosomal protein L7-A (chains F)
MAAEKILTPESQLKKSKAQQKTAEQVAAERAARKAANKEKRAIILERNAAYQKEYETAER
NIIQAKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVT
KATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILS
IDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLV
KSMN
Sequence of entity 7 (G), FASTA
>7BT6_7 60S ribosomal protein L8-A (chains G)
MAPGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQR
QKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEGK
SKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIV
KGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGN
KAQAKMDKRAKNSDSA
Sequence of entity 8 (H), FASTA
>7BT6_8 60S ribosomal protein L9-A (chains H)
MKYIQTEQQIEVPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNNQLIKVAVHNG
GRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPINVNIVEKDGAKFIEVRNFLGD
KKIRNVPVRDGVTIEFSTNVKDEIVLSGNSVEDVSQNAADLQQICRVRNKDIRKFLDGIY
VSHKGFITEDL
Sequence of entity 9 (J), FASTA
>7BT6_9 60S ribosomal protein L11-A (chains J)
MSAKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSI
GIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK
Sequence of entity 10 (L), FASTA
>7BT6_10 60S ribosomal protein L13-A (chains L)
MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRA
PTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQ
SKIIVFPRNGKAPEAEQVLSAAATFPIAQPATDVEARAVQDNGESAFRTLRLARSEKKFR
GIREKRAREKAEAEAEKKK
Sequence of entity 11 (M), FASTA
>7BT6_11 60S ribosomal protein L14-A (chains M)
MSTDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINL
GQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQV
MVLRKQKRYTVKKALAKA
Sequence of entity 12 (N), FASTA
>7BT6_12 60S ribosomal protein L15-A (chains N)
MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRLGYKAKQGFV
IYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRAANLRVLNSYW
VNQDSTYKYFEVILVDPQHKAIRRDARYNWICDPVHKHREARGLTATGKKSRGINKGHKF
NNTKAGRRKTWKRQNTLSLWRYRK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 2 |
| MG | Magnesium ion | Mg | 2 |
| ZN | Zinc ion | Zn | 3 |
Primary citation
Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel. Wilson, D.M., Li, Y., LaPeruta, A. et al. Nat Commun (2020) 11:5111-5111. DOI 10.1038/s41467-020-18878-8 · PubMed
Other PDB entries of the same protein (UniProt P0CX45 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9PN5 1.75 Å, Composite map of hypomethylated 80S ribosome treated with hygromycin B
- 8CCS 1.97 Å, 80S S. cerevisiae ribosome with ligands in hybrid-1 pre-translocation (PRE-H1) complex
- 8CDR 2.04 Å, Translocation intermediate 2 (TI-2) of 80S S. cerevisiae ribosome with ligands and eEF2…
- 8CEH 2.05 Å, Translocation intermediate 4 (TI-4) of 80S S. cerevisiae ribosome with ligands and eEF2…
- 8P8N 2.15 Å, Mouse RPL39 integrated into the yeast 60S ribosomal subunit
- 8PFR 2.15 Å, Mouse RPL39L integrated into the yeast 60S ribosomal subunit
- 8EVT 2.2 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
- 8T2Y 2.2 Å, Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, and A-site tRNA,…
- 8P8U 2.23 Å, Yeast 60S ribosomal subunit
- 8CGN 2.28 Å, Non-rotated 80S S. cerevisiae ribosome with ligands
- 8ZHC 2.3 Å, pre-frameshift complex of yeast 80S ribosome with eRF1 and mRNA of WNV
- 7UOO 2.34 Å, Nucleoplasmic pre-60S intermediate of the Nog2 containing pre-rotation state
Browse structure collections
About this viewer
MolViewer shows 7BT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.