7BYK: Legionella pneumophila LegK7 effector kinase

Crystal structure of the Legionella pneumophila LegK7 effector kinase. Determined by X-ray diffraction at 2.65 Å resolution. Released 30 Dec 2020.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Legionella pneumophila
Chains: 2
Atoms: 7,084
Mol. weight: 110.8 kDa
Released: 30 Dec 2020

Explore 7BYK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BYK contains 64 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	1-7	7
α-helix	14-22	9
α-helix	28-43	16
α-helix	49-55	7
α-helix	63-68	6
β-strand	76	1	1
α-helix	78-91	14
α-helix	106-119	14
α-helix	122-124	3
α-helix	126-142	17
α-helix	144-168	25
α-helix	172-174	3
α-helix	176-177	2
β-strand	194-197	4	1
α-helix	205	1
β-strand	206-210	5	1
α-helix	217-222	6
α-helix	226-230	5
α-helix	232-233	2
β-strand	234-243	10	1
β-strand	249-258	10	1
α-helix	263	1
β-strand	264	1	2
α-helix	265-273	9
α-helix	277-279	3
α-helix	280-300	21
β-strand	304	1	3
α-helix	310-312	3
β-strand	313-315	3	2
β-strand	320-322	3	2
β-strand	329	1	3
β-strand	335	1	4
α-helix	336-338	3
α-helix	343-345	3
α-helix	348-351	4
β-strand	354-356	3	5
β-strand	362-365	4	5
α-helix	367-370	4
β-strand	373	1	4
α-helix	376-394	19
α-helix	412-414	3
α-helix	420-432	13
α-helix	437-439	3
α-helix	441-442	2
α-helix	443-450	8
α-helix	457-467	11

Chain B: 32 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	1-7	7
α-helix	14-22	9
α-helix	28-43	16
α-helix	49-55	7
α-helix	63-69	7
β-strand	76	1	6
α-helix	78-91	14
α-helix	106-119	14
α-helix	122-125	4
α-helix	126-142	17
α-helix	144-168	25
α-helix	172-174	3
α-helix	176-177	2
β-strand	194-197	4	6
α-helix	205	1
β-strand	206-210	5	6
α-helix	217-222	6
α-helix	226-230	5
α-helix	232-233	2
β-strand	234-243	10	6
β-strand	249-258	10	6
α-helix	263	1
β-strand	264	1	7
α-helix	265-273	9
α-helix	277-279	3
α-helix	280-300	21
β-strand	304	1	8
α-helix	310-312	3
β-strand	313-316	4	7
β-strand	319-322	4	7
β-strand	329	1	8
β-strand	335	1	9
α-helix	336-338	3
α-helix	343-345	3
α-helix	348-351	4
β-strand	354-356	3	10
β-strand	362-365	4	10
α-helix	367-370	4
β-strand	373	1	9
α-helix	376-394	19
α-helix	412-414	3
α-helix	420-432	13
α-helix	437-439	3
α-helix	441-442	2
α-helix	443-450	8
α-helix	457-467	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LegK7	A, B	protein	477	Legionella pneumophila	Q5ZU83 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7BYK_1 LegK7 (chains A, B)
GSAKDPMPLNLPPKSSKNTMPLVIAYNNAPEDDKIQKLFYLQKINYLLNKTQLNDDLFDW
INDAEEGGWLNELAKFSINPNASFFLKGMQFAKAITEEIKNKPEINSSEVNIYHLMQERD
QLLKEVEFEKCATRYAEINFLLNELALNDKKTKEIVERQTEILRLVAPKIKAIKGESIDN
LPVIPSYKTKELGNHVNNFNFKFTMSGWEAPFVFRVEDRHELGKEQELHSYGVSKYFIED
YSVFMMRFKAEDGSTVYKPVILSQFANQNNLEEIAKQLKDGSPKNIAPRIGYYFVQLTDF
CLKLIETHNYHPDIKLNNFLVHNNRVLVSDRKTFTTNDNPLASEILTSPLFAPDEFLKCL
LFNKEGDPVGYNRNALWKRMNMPQFMAYQLGMALKQFLILTQLDELPDDFRNPDHSAVSH
FKTPSRQIINLSLLVQELTRLDPDKRMTIKQFQTLLNFKNLPPDAFYQKVEEVFPSS

Primary citation

Activation of the Legionella pneumophila LegK7 Effector Kinase by the Host MOB1 Protein. Park, S.C., Cho, S.Y., Kim, T.H. et al. J Mol Biol (2020) 433:166746-166746. DOI 10.1016/j.jmb.2020.166746 · PubMed

Other PDB entries of the same protein (UniProt Q5ZU83 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MCP 2.5 Å, L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A
6MCQ 2.57 Å, L. pneumophila effector kinase LegK7 in complex with human MOB1A

Browse structure collections

About this viewer

MolViewer shows 7BYK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.