The NADPH binding site on beef liver catalase. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Apr 1985.
Explore 7CAT in 3D Show helices and sheets RCSB PDB PDBe
7CAT contains 64 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-9 | 3 | |
| α-helix | 10-16 | 7 | |
| α-helix | 23-26 | 4 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 32 | 1 | |
| β-strand | 33 | 1 | 1 |
| α-helix | 34 | 1 | |
| β-strand | 42-43 | 2 | 2 |
| α-helix | 48 | 1 | |
| β-strand | 49 | 1 | 2 |
| α-helix | 50 | 1 | |
| α-helix | 56-63 | 8 | |
| α-helix | 69-71 | 3 | |
| β-strand | 77-86 | 10 | 3 |
| α-helix | 97-99 | 3 | |
| β-strand | 105-113 | 9 | 3 |
| β-strand | 130-136 | 7 | 3 |
| β-strand | 141-147 | 7 | 3 |
| α-helix | 157-159 | 3 | |
| α-helix | 160-165 | 6 | |
| β-strand | 169 | 1 | 4 |
| β-strand | 176 | 1 | 4 |
| α-helix | 178-187 | 10 | |
| α-helix | 189-191 | 3 | |
| α-helix | 192-198 | 7 | |
| β-strand | 205 | 1 | 5 |
| α-helix | 208-210 | 3 | |
| β-strand | 213-214 | 2 | 3 |
| β-strand | 219-222 | 4 | 3 |
| β-strand | 228-237 | 10 | 3 |
| β-strand | 243 | 1 | 5 |
| α-helix | 246-255 | 10 | |
| α-helix | 259-269 | 11 | |
| β-strand | 275-283 | 9 | 3 |
| α-helix | 285-290 | 6 | |
| α-helix | 301-303 | 3 | |
| β-strand | 310-319 | 10 | 3 |
| α-helix | 324 | 1 | |
| α-helix | 325-329 | 5 | |
| β-strand | 340 | 1 | 3 |
| β-strand | 342-344 | 3 | 3 |
| α-helix | 348-364 | 17 | |
| α-helix | 369-371 | 3 | |
| α-helix | 373-375 | 3 | |
| α-helix | 415-417 | 3 | |
| α-helix | 418-421 | 4 | |
| β-strand | 428-429 | 2 | 6 |
| α-helix | 440-444 | 5 | |
| α-helix | 445-449 | 5 | |
| α-helix | 453-466 | 14 | |
| α-helix | 471-484 | 14 | |
| α-helix | 486-499 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Catalase | A, B | protein | 506 | Bos taurus | P00432 (AlphaFold model) |
>7CAT_1 CATALASE (chains A, B) ADNRDPASDQMKHWKEQRAAQKPDVLTTGGGNPVGDKLNSLTVGPRGPLLVQDVVFTDEM AHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVAGESG SADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDALLFPSFIHSQKRNPQTHLKDPDM VWDFWSLRPESLHQVSFLFSDRGIPDGHRHMDGYGSHTFKLVNADGEAVYCKFHYKTDQG IKNLSVEDAARLAHEDPDYGLRDLFNAIATGNYPSWTLYIQVMTFSEAEIFPFNPFDLTK VWPHGDYPLIPVGKLVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFAYPDT HRHRLGPNYLQIPVNCPYRARVANYQRDGPMCMMDNQGGAPNYYPNSFSAPEHQPSALEH RTHFSGDVQRFNSANDDNVTQVRTFYLKVLNEEQRKRLCENIAGHLKDAQLFIQKKAVKN FSDVHPEYGSRIQALLDKYNEEKPKN
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 2 |
| NDP | NADPH dihydro-nicotinamide-adenine-dinucleotide phosphate | C21 H30 N7 O17 P3 | 2 |
The NADPH binding site on beef liver catalase. Fita, I., Rossmann, M.G. Proc Natl Acad Sci U S A (1985) 82:1604-1608. DOI 10.1073/pnas.82.6.1604 · PubMed
Other PDB entries of the same protein (UniProt P00432 (AlphaFold model), which also has an AlphaFold model), best resolution first:
7CAT is part of these collections:
MolViewer shows 7CAT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.