7CLV: Mitochondrial Tim23 channel

Solution structure of mitochondrial Tim23 channel in complex with a signaling peptide. Determined by solution NMR. Released 30 Dec 2020.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 3,471
Mol. weight: 49.53 kDa
Released: 30 Dec 2020

Explore 7CLV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CLV contains 24 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	12-16	5
α-helix	30-33	4
α-helix	39-43	5
α-helix	63-82	20
α-helix	95-98	4
α-helix	103-123	21
α-helix	135-139	5
α-helix	155-168	14
α-helix	184-188	5
α-helix	198-213	16
α-helix	218-221	4

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	12-16	5
α-helix	30-34	5
α-helix	39-46	8
α-helix	55-58	4
α-helix	60-61	2
α-helix	62-82	21
α-helix	95-99	5
α-helix	103-120	18
α-helix	133-139	7
α-helix	150-168	19
α-helix	182-190	9
α-helix	198-213	16
α-helix	218-220	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TIM23 isoform 1	A, B	protein	222	Saccharomyces cerevisiae	P32897 (AlphaFold model)
COX4 isoform 1	C	protein	25	Saccharomyces cerevisiae	P04037 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7CLV_1 TIM23 isoform 1 (chains A, B)
MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP
LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG
LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG
AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK

Sequence of entity 2 (C), FASTA

>7CLV_2 COX4 isoform 1 (chains C)
MLSLRQSIRFFKPATRTLCSSRYLL

Primary citation

Solution structure of the voltage-gated Tim23 channel in complex with a mitochondrial presequence peptide. Zhou, S., Ruan, M., Li, Y. et al. Cell Res (2021) 31:821-824. DOI 10.1038/s41422-020-00452-y · PubMed

Other PDB entries of the same protein (UniProt P32897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E1M 2.9 Å, Cryo-EM structure of the endogenous core TIM23 complex from S. cerevisiae
9N84 3.2 Å, Yeast TIM23 complex inhibited by stendomycin
9J9B 3.83 Å, Substrate-engaged TIM23 complex from yeast

Browse structure collections

About this viewer

MolViewer shows 7CLV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.