Crystal structure of the DOCK8 DHR-1 domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 10 Feb 2021.
Explore 7CLX in 3D Show helices and sheets RCSB PDB PDBe
7CLX contains 6 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 559-571 | 13 | 1 |
| α-helix | 580-582 | 3 | |
| β-strand | 584-590 | 7 | 2 |
| α-helix | 595-597 | 3 | |
| β-strand | 598 | 1 | 2 |
| β-strand | 602-603 | 2 | 1 |
| β-strand | 611-612 | 2 | 1 |
| β-strand | 615-617 | 3 | 2 |
| β-strand | 632-635 | 4 | 1 |
| β-strand | 645-653 | 9 | 2 |
| α-helix | 658-660 | 3 | |
| β-strand | 664-673 | 10 | 2 |
| β-strand | 675-676 | 2 | 3 |
| β-strand | 679-680 | 2 | 3 |
| β-strand | 683-687 | 5 | 1 |
| β-strand | 690-691 | 2 | 2 |
| α-helix | 698-700 | 3 | |
| α-helix | 712-713 | 2 | |
| β-strand | 715 | 1 | 2 |
| α-helix | 716-719 | 4 | |
| β-strand | 723-734 | 12 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dedicator of cytokinesis protein 8 | A | protein | 192 | Mus musculus | Q8C147 (AlphaFold model) |
>7CLX_1 Dedicator of cytokinesis protein 8 (chains A) GSSGSSGPHTVYRNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSG PEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLG YSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQ AVSSVHTQDNHL
A conserved PI(4,5)P2-binding domain is critical for immune regulatory function of DOCK8. Sakurai, T., Kukimoto-Niino, M., Kunimura, K. et al. Life Sci Alliance (2021) 4. DOI 10.26508/lsa.202000873 · PubMed
Other PDB entries of the same protein (UniProt Q8C147 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7CLX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.