7CLX: DOCK8 DHR-1 domain

Crystal structure of the DOCK8 DHR-1 domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,673
Mol. weight: 21.48 kDa
Released: 10 Feb 2021

Explore 7CLX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CLX contains 6 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	559-571	13	1
α-helix	580-582	3
β-strand	584-590	7	2
α-helix	595-597	3
β-strand	598	1	2
β-strand	602-603	2	1
β-strand	611-612	2	1
β-strand	615-617	3	2
β-strand	632-635	4	1
β-strand	645-653	9	2
α-helix	658-660	3
β-strand	664-673	10	2
β-strand	675-676	2	3
β-strand	679-680	2	3
β-strand	683-687	5	1
β-strand	690-691	2	2
α-helix	698-700	3
α-helix	712-713	2
β-strand	715	1	2
α-helix	716-719	4
β-strand	723-734	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dedicator of cytokinesis protein 8	A	protein	192	Mus musculus	Q8C147 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CLX_1 Dedicator of cytokinesis protein 8 (chains A)
GSSGSSGPHTVYRNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSG
PEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLG
YSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQ
AVSSVHTQDNHL

Primary citation

A conserved PI(4,5)P2-binding domain is critical for immune regulatory function of DOCK8. Sakurai, T., Kukimoto-Niino, M., Kunimura, K. et al. Life Sci Alliance (2021) 4. DOI 10.26508/lsa.202000873 · PubMed

Other PDB entries of the same protein (UniProt Q8C147 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CLY 1.43 Å, Structure of the DOCK8 DHR-1 domain crystallized with di-C8-phosphatidylinositol-(4,5)-bi…
3VHL 2.08 Å, Crystal structure of the DHR-2 domain of DOCK8 in complex with Cdc42 (T17N mutant)

Browse structure collections

About this viewer

MolViewer shows 7CLX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.