Crystal structure of fission yeast Ccq1 and Tpz1. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Aug 2021.
Explore 7CUJ in 3D Show helices and sheets RCSB PDB PDBe
7CUJ contains 38 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 133-138 | 6 | 1 |
| α-helix | 139-141 | 3 | |
| α-helix | 142-154 | 13 | |
| α-helix | 156-163 | 8 | |
| α-helix | 169-187 | 19 | |
| α-helix | 189-192 | 4 | |
| α-helix | 219-221 | 3 | |
| α-helix | 224-234 | 11 | |
| β-strand | 243-248 | 6 | 1 |
| α-helix | 251-263 | 13 | |
| β-strand | 268-270 | 3 | 1 |
| β-strand | 284-288 | 5 | 1 |
| α-helix | 289-291 | 3 | |
| α-helix | 292-295 | 4 | |
| α-helix | 296-299 | 4 | |
| β-strand | 306-310 | 5 | 1 |
| α-helix | 313-322 | 10 | |
| α-helix | 324-326 | 3 | |
| β-strand | 330-335 | 6 | 1 |
| α-helix | 339-345 | 7 | |
| α-helix | 354-365 | 12 | |
| α-helix | 397-416 | 20 | |
| α-helix | 421-423 | 3 | |
| α-helix | 427-431 | 5 | |
| α-helix | 433-435 | 3 | |
| β-strand | 438 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 133-138 | 6 | 4 |
| α-helix | 139-141 | 3 | |
| α-helix | 142-154 | 13 | |
| α-helix | 156-164 | 9 | |
| α-helix | 169-187 | 19 | |
| α-helix | 189-192 | 4 | |
| α-helix | 224-236 | 13 | |
| β-strand | 243-248 | 6 | 4 |
| α-helix | 251-261 | 11 | |
| β-strand | 268-270 | 3 | 4 |
| β-strand | 284-288 | 5 | 4 |
| α-helix | 289-291 | 3 | |
| α-helix | 292-298 | 7 | |
| β-strand | 306-310 | 5 | 4 |
| α-helix | 313-322 | 10 | |
| β-strand | 330-335 | 6 | 4 |
| α-helix | 339-346 | 8 | |
| α-helix | 347-349 | 3 | |
| α-helix | 354-365 | 12 | |
| α-helix | 397-416 | 20 | |
| α-helix | 421-423 | 3 | |
| α-helix | 427-431 | 5 | |
| α-helix | 433-435 | 3 | |
| β-strand | 438 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 431 | 1 | 3 |
| α-helix | 441-465 | 25 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 431 | 1 | 2 |
| α-helix | 441-461 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coiled-coil quantitatively-enriched protein 1 | A, B | protein | 317 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | Q10432 (AlphaFold model) |
| Protection of telomeres protein tpz1 | C, D | protein | 45 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | O14246 (AlphaFold model) |
>7CUJ_1 Coiled-coil quantitatively-enriched protein 1 (chains A, B) ITKSSKSSFSVLDIGLPMSALQRKMMHRLVQYFAFCIDHFCTGPSDSRIQEKIRLFIQSA HNIAKHPSLYDTEVRNPSAAESTNSHVSLDASNFSSYAENSSKFLFLQELFKNLSPSYSK TFFLFISNQFLANTLTQWLKSQNIDAELWAEEDAKTSQHPAIWICVSKKAPSASHFLQSC PDLSATIFYDIEAYMSVTSSLPSIQSLVLRLIHLGSIEHAIKCFQSSYNASFLVNIVGVV ATLSSSSEENSEASNLSTLFEKSGNFEEILGSESHSSITEKTRDIAKNVATWLKNGENFS SWPLPPLMDLASLSVAE
>7CUJ_2 Protection of telomeres protein tpz1 (chains C, D) QIELEYKRKPIPDYDFMKGLETTLQELYVEHQSKKRRLELFQLTN
Structural insights into Pot1-ssDNA, Pot1-Tpz1 and Tpz1-Ccq1 Interactions within fission yeast shelterin complex. Sun, H., Wu, Z., Zhou, Y. et al. PLoS Genet (2022) 18:e1010308-e1010308. DOI 10.1371/journal.pgen.1010308 · PubMed
MolViewer shows 7CUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.