7CZB: Derlin-1

The cryo-EM structure of the ERAD retrotranslocation channel formed by human Derlin-1. Determined by electron microscopy at 3.8 Å resolution. Released 17 Mar 2021.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,304
Mol. weight: 115.29 kDa
Released: 17 Mar 2021

Explore 7CZB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CZB contains 40 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	17-31	15
α-helix	36-38	3
α-helix	43-48	6
α-helix	58-60	3
α-helix	70-88	19
α-helix	95-104	10
α-helix	106-115	10
α-helix	123-135	13
α-helix	150-151	2
α-helix	155-165	11
α-helix	171-187	17

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	17-30	14
α-helix	36-38	3
α-helix	44-47	4
α-helix	54-57	4
β-strand	65	1	1
β-strand	68	1	1
α-helix	71-89	19
α-helix	95-115	21
α-helix	123-136	14
β-strand	142	1	2
β-strand	149	1	2
α-helix	155-166	12
α-helix	174-188	15

Chain D: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	17-30	14
α-helix	36-38	3
α-helix	44-47	4
α-helix	54-57	4
β-strand	65	1	3
β-strand	68	1	3
α-helix	71-89	19
α-helix	95-115	21
α-helix	123-136	14
α-helix	155-166	12
α-helix	174-188	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Derlin-1	A, B, C, D	protein	251	Homo sapiens	Q9BUN8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7CZB_1 Derlin-1 (chains A, B, C, D)
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF
YFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ

Primary citation

The cryo-EM structure of an ERAD protein channel formed by tetrameric human Derlin-1. Rao, B., Li, S., Yao, D. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abe8591 · PubMed

Other PDB entries of the same protein (UniProt Q9BUN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GLF 2.25 Å, Structural insights into the interaction of p97 N-terminal domain and SHP motif in…
9LLK 3.55 Å, The cryo-EM structure of the heterododecameric human Derlin-1/p97 complex
7Y53 3.61 Å, The cryo-EM structure of human ERAD retro-translocation complex
7Y4W 3.67 Å, The cryo-EM structure of human ERAD retro-translocation complex
7Y59 4.51 Å, The cryo-EM structure of human ERAD retro-translocation complex

Browse structure collections

About this viewer

MolViewer shows 7CZB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.