7D3Y: OsPHR2-osSPX2 complex
Crystal structure of the osPHR2-osSPX2 complex. Determined by X-ray diffraction at 3.11 Å resolution. Released 6 Oct 2021.
- Method
- X-ray diffraction
- Resolution
- 3.11 Å
- Organisms
- Oryza sativa subsp. indica, Homo sapiens, Oryza sativa subsp. japonica
- Chains
- 5
- Atoms
- 7,393
- Mol. weight
- 138.62 kDa
- Ligands
- IHP
- Released
- 6 Oct 2021
Explore 7D3Y in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7D3Y contains 33 α-helices and 18 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| α-helix | 23-24 | 2 | |
| α-helix | 27-33 | 7 | |
| α-helix | 68-152 | 85 | |
| α-helix | 157-165 | 9 | |
| α-helix | 173-189 | 17 | |
| β-strand | 209-215 | 7 | 1 |
| β-strand | 221-226 | 6 | 1 |
| β-strand | 236-241 | 6 | 1 |
| α-helix | 250-258 | 9 | |
| α-helix | 261-274 | 14 | |
| β-strand | 282-286 | 5 | 1 |
| β-strand | 294-299 | 6 | 1 |
| α-helix | 308-325 | 18 | |
| β-strand | 330-333 | 4 | 1 |
| β-strand | 338 | 1 | 2 |
| α-helix | 339-341 | 3 | |
| β-strand | 343 | 1 | 2 |
| α-helix | 345-362 | 18 | |
| β-strand | 370-374 | 5 | 1 |
| α-helix | 378-388 | 11 | |
Chain B: 11 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-12 | 6 | |
| α-helix | 27-33 | 7 | |
| α-helix | 68-152 | 85 | |
| α-helix | 157-165 | 9 | |
| α-helix | 173-189 | 17 | |
| β-strand | 209-215 | 7 | 3 |
| β-strand | 221-226 | 6 | 3 |
| β-strand | 236-241 | 6 | 3 |
| α-helix | 250-259 | 10 | |
| α-helix | 261-274 | 14 | |
| β-strand | 282-286 | 5 | 3 |
| β-strand | 294-299 | 6 | 3 |
| α-helix | 300-302 | 3 | |
| α-helix | 308-325 | 18 | |
| β-strand | 330-333 | 4 | 3 |
| β-strand | 338 | 1 | 4 |
| β-strand | 343 | 1 | 4 |
| α-helix | 345-362 | 18 | |
| β-strand | 370-374 | 5 | 3 |
| α-helix | 378-389 | 12 | |
Chain C: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 253-266 | 14 | |
| α-helix | 274-280 | 7 | |
| α-helix | 288-302 | 15 | |
| α-helix | 305-307 | 3 | |
| α-helix | 331-369 | 39 | |
Chain D: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 253-265 | 13 | |
| α-helix | 274-279 | 6 | |
| α-helix | 288-301 | 14 | |
| α-helix | 331-364 | 34 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 331-363 | 33 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| SPX domain-containing protein 2,Isoform 1 of Core histone macro-H2A.1 | A, B | protein | 394 | Oryza sativa subsp. indica, Homo sapiens | A2X254 (AlphaFold model), O75367 (AlphaFold model) |
| Protein PHOSPHATE STARVATION RESPONSE 2 | C, D, E | protein | 148 | Oryza sativa subsp. japonica | Q6Z156 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>7D3Y_1 SPX domain-containing protein 2,Isoform 1 of Core histone macro-H2A.1 (chains A, B)
MKFGKSLSSQIVEMQPEWRDNFLSYKDLKKRLNLISGGAAGERASKRRRVGGATAVTVTA
AAAGGMTLEQAGFVGLLDAELDKFNFFFLEKEEEYVIKQKELRERKMASAEEVMRVRKEI
VDLHGEMVLLENYSALNYTGLVKILKKYDKRTGSMIRLPFVQKVLQQPFFTTDLLYKLVK
ECEEMLDQLMPTNEHSVASEDGAGSDGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHP
TNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNS
PVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYF
VSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN
Sequence of entity 2 (C, D, E), FASTA
>7D3Y_2 Protein PHOSPHATE STARVATION RESPONSE 2 (chains C, D, E)
SGEPSAVAIPSPSGASNTSNSKTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKAD
NLTIYHVKSHLQKYRTARYRPELSEGSSEKKAASKEDIPSIDLKGGNFDLTEALRLQLEL
QKRLHEQLEIQRSLQLRILEHHHHHHHH
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| IHP | Inositol hexakisphosphate | C6 H18 O24 P6 | 2 |
Primary citation
Mechanistic insights into the regulation of plant phosphate homeostasis by the rice SPX2 - PHR2 complex. Guan, Z., Zhang, Q., Zhang, Z. et al. Nat Commun (2022) 13:1581-1581. DOI 10.1038/s41467-022-29275-8 · PubMed
Browse structure collections
About this viewer
MolViewer shows 7D3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.