7D5Y: Cystein protease domain from MARTX toxin

Name: PDB 7D5Y: Cystein protease domain from MARTX toxin
Published: 2021-05-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Cystein protease domain from MARTX toxin. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 May 2021.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Vibrio vulnificus
Chains: 1
Atoms: 1,732
Mol. weight: 23.23 kDa
Released: 12 May 2021

Explore 7D5Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D5Y contains 6 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4092	1	1
β-strand	4093	1	2
α-helix	4097-4098	2
α-helix	4103-4105	3
β-strand	4125-4129	5	3
α-helix	4134-4146	13
β-strand	4151-4156	6	3
β-strand	4162-4166	5	3
α-helix	4169-4171	3
β-strand	4174-4182	9	3
β-strand	4184-4186	3	2
β-strand	4193-4195	3	2
β-strand	4198	1	2
α-helix	4200-4217	18
β-strand	4222-4231	10	3
β-strand	4235	1	1
α-helix	4237-4253	17
β-strand	4259-4264	6	3
β-strand	4267-4269	3	4
β-strand	4274-4276	3	4
β-strand	4277-4278	2	5
β-strand	4284-4285	2	5
β-strand	4292-4295	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Martx	A	protein	210	Vibrio vulnificus	A0A023NA98

Sequence of entity 1 (A), FASTA

>7D5Y_1 MARTX (chains A)
WTGATSKADNQNVNDWERVVVTPAVDGGETRFDGQIIVQMENDAVAAKAAANLAGKHPES
SVVVQLDSDGNYRVVYGDPSKLDGKIRWQLVGHGRDHSESNNTRLSGYSADELAVKLASF
QQMFNQAEKISSKPDHISIVGCSLVSDDKQKGFGHQFINAMDANGLRVDVSVRSAKVYIN
EMGRKLYFDGKDSWVNKAINSKVLLSWNGQ

Primary citation

Cystein protease domain from MARTX toxin. Kim, M.-H., Hwang, J., Choi, S. To be published.

Other PDB entries of the same protein (UniProt A0A023NA98), best resolution first:

7P1H 3.9 Å, Structure of the V. vulnificus ExoY-G-actin-profilin complex

Browse structure collections

About this viewer

MolViewer shows 7D5Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.