Cystein protease domain from MARTX toxin. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 May 2021.
Explore 7D5Y in 3D Show helices and sheets RCSB PDB PDBe
7D5Y contains 6 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4092 | 1 | 1 |
| β-strand | 4093 | 1 | 2 |
| α-helix | 4097-4098 | 2 | |
| α-helix | 4103-4105 | 3 | |
| β-strand | 4125-4129 | 5 | 3 |
| α-helix | 4134-4146 | 13 | |
| β-strand | 4151-4156 | 6 | 3 |
| β-strand | 4162-4166 | 5 | 3 |
| α-helix | 4169-4171 | 3 | |
| β-strand | 4174-4182 | 9 | 3 |
| β-strand | 4184-4186 | 3 | 2 |
| β-strand | 4193-4195 | 3 | 2 |
| β-strand | 4198 | 1 | 2 |
| α-helix | 4200-4217 | 18 | |
| β-strand | 4222-4231 | 10 | 3 |
| β-strand | 4235 | 1 | 1 |
| α-helix | 4237-4253 | 17 | |
| β-strand | 4259-4264 | 6 | 3 |
| β-strand | 4267-4269 | 3 | 4 |
| β-strand | 4274-4276 | 3 | 4 |
| β-strand | 4277-4278 | 2 | 5 |
| β-strand | 4284-4285 | 2 | 5 |
| β-strand | 4292-4295 | 4 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Martx | A | protein | 210 | Vibrio vulnificus | A0A023NA98 |
>7D5Y_1 MARTX (chains A) WTGATSKADNQNVNDWERVVVTPAVDGGETRFDGQIIVQMENDAVAAKAAANLAGKHPES SVVVQLDSDGNYRVVYGDPSKLDGKIRWQLVGHGRDHSESNNTRLSGYSADELAVKLASF QQMFNQAEKISSKPDHISIVGCSLVSDDKQKGFGHQFINAMDANGLRVDVSVRSAKVYIN EMGRKLYFDGKDSWVNKAINSKVLLSWNGQ
Cystein protease domain from MARTX toxin. Kim, M.-H., Hwang, J., Choi, S. To be published.
Other PDB entries of the same protein (UniProt A0A023NA98), best resolution first:
MolViewer shows 7D5Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.