The crystal structure of ScNTM1 in complex with SAH. Determined by X-ray diffraction at 1.15 Å resolution. Released 26 May 2021.
Explore 7D8F in 3D Show helices and sheets RCSB PDB PDBe
7D8F contains 18 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-8 | 4 | |
| α-helix | 11-19 | 9 | |
| α-helix | 25-28 | 4 | |
| α-helix | 38-52 | 15 | |
| α-helix | 54-56 | 3 | |
| β-strand | 66-70 | 5 | 1 |
| α-helix | 76-77 | 2 | |
| α-helix | 78-82 | 5 | |
| α-helix | 83-85 | 3 | |
| β-strand | 88-92 | 5 | 1 |
| α-helix | 96-105 | 10 | |
| α-helix | 107-111 | 5 | |
| β-strand | 115-119 | 5 | 1 |
| α-helix | 123-125 | 3 | |
| α-helix | 128-129 | 2 | |
| β-strand | 133-139 | 7 | 1 |
| α-helix | 142-144 | 3 | |
| α-helix | 147-159 | 13 | |
| β-strand | 161-172 | 12 | 1 |
| β-strand | 180-182 | 3 | 2 |
| β-strand | 187-189 | 3 | 2 |
| α-helix | 192-201 | 10 | |
| β-strand | 204-211 | 8 | 1 |
| α-helix | 212-213 | 2 | |
| α-helix | 220-221 | 2 | |
| β-strand | 222-229 | 8 | 1 |
| α-helix | 230-231 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha N-terminal protein methyltransferase 1 | A | protein | 234 | Saccharomyces cerevisiae | P38340 (AlphaFold model) |
>7D8F_1 Alpha N-terminal protein methyltransferase 1 (chains A) HHMDVPADSHIKYEDAIDYWTDVDATVDGVLGGYGEGTVVPTMDVLGSNNFLRKLKSRML PQENNVKYAVDIGAGIGRVSKTMLHKHAAKIDLVEPVKPFIEQMHVELAELKDKGQIGQI YEVGMQDWTPDAGKYWLIWCQWCVGHLPDAELVAFLKRCIVGLQPNGTIVVKENNTPTDT DDFDETDSSVTRSDAKFRQIFEEAGLKLIASERQRGLPRELYPVRMYALKPMPN
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 1 |
Structural Basis for Peptide Binding of Alpha-N Terminal Methyltransferase from Saccharomyces cerevisiae. Zhang, H.Y., Kuang, Z., Xue, L. et al. Crystallogr Rep (2021) 66:1316-1321. DOI 10.1134/S1063774521070257
Other PDB entries of the same protein (UniProt P38340 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7D8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.