7DCF: EHMT2 SET domain

Crystal structure of EHMT2 SET domain in complex with compound 10. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,532
Mol. weight: 67.15 kDa
Ligands: ZN, SAM, H30
Released: 10 Feb 2021

Explore 7DCF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DCF contains 23 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	921-923	3	1
β-strand	937-938	2	1
β-strand	951-952	2	2
β-strand	957	1	3
β-strand	958	1	4
α-helix	961-962	2
α-helix	968-970	3
β-strand	996	1	5
α-helix	1001	1
β-strand	1002	1	5
α-helix	1003	1
α-helix	1011-1013	3
β-strand	1014-1015	2	6
α-helix	1032-1034	3
β-strand	1040-1044	5	1
β-strand	1050-1054	5	1
β-strand	1058	1	7
β-strand	1063-1067	5	6
β-strand	1070-1073	4	3
α-helix	1074-1077	4
β-strand	1086-1089	4	3
β-strand	1097-1100	4	3
β-strand	1104-1105	2	2
α-helix	1107-1110	4
α-helix	1111	1
β-strand	1112-1113	2	8
β-strand	1119-1125	7	6
β-strand	1135-1140	6	6
β-strand	1144	1	7
α-helix	1148	1
β-strand	1149	1	1
α-helix	1150	1
β-strand	1151-1152	2	8
α-helix	1156-1162	7
α-helix	1179-1184	6

Chain B: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	921-923	3	9
β-strand	937-938	2	9
α-helix	944-947	4
β-strand	951-952	2	10
β-strand	957-958	2	11
β-strand	967	1	4
α-helix	968-970	3
α-helix	986-989	4
β-strand	992	1	12
β-strand	994-996	3	13
β-strand	1002-1004	3	13
β-strand	1013-1015	3	12
β-strand	1040-1044	5	9
β-strand	1050-1054	5	9
β-strand	1058	1	14
β-strand	1063-1067	5	12
β-strand	1070-1073	4	11
α-helix	1074-1079	6
β-strand	1086-1090	5	11
β-strand	1096-1100	5	11
β-strand	1104-1105	2	10
α-helix	1107-1110	4
α-helix	1111	1
β-strand	1112-1113	2	15
β-strand	1119-1125	7	12
β-strand	1135-1140	6	12
β-strand	1144	1	14
α-helix	1148	1
β-strand	1149	1	9
α-helix	1150	1
β-strand	1151-1152	2	15
α-helix	1156-1162	7
α-helix	1179-1183	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase EHMT2	A, B	protein	283	Homo sapiens	Q96KQ7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7DCF_1 Histone-lysine N-methyltransferase EHMT2 (chains A, B)
GSNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRNITH
LQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNR
VVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLD
NKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEEL
GFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	2
H30	5'-methoxy-6'-(1-methyl-2,3,4,7-tetrahydroazepin-5-yl)spiro[cyclobutane-1,3'-in…	C19 H25 N3 O	2

Primary citation

Discovery of DS79932728: A Potent, Orally Available G9a/GLP Inhibitor for Treating beta-Thalassemia and Sickle Cell Disease. Katayama, K., Ishii, K., Terashima, H. et al. ACS Med Chem Lett (2021) 12:121-128. DOI 10.1021/acsmedchemlett.0c00572 · PubMed

Other PDB entries of the same protein (UniProt Q96KQ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VSC 1.4 Å, Structure of human G9a SET-domain (EHMT2) in complex with inhibitor 13
7XUD 1.45 Å, Structure of G9a in complex with compound 26a
5JIY 1.48 Å, Structure of G9a SET-domain with Histone H3K9norLeucine mutant peptide and bound…
7X73 1.49 Å, Structure of G9a in complex with RK-701
8Z7C 1.52 Å, Structure of G9a in complex with compound 7i
8Z7E 1.54 Å, Structure of G9a in complex with compound 9b
8Z7D 1.58 Å, Structure of G9a in complex with compound 9a
5VSE 1.6 Å, Structure of human G9a SET-domain (EHMT2) in complex with inhibitor 17:…
5JHN 1.67 Å, Structure of G9a SET-domain with Histone H3K9Ala mutant peptide and bound…
7XUC 1.67 Å, Structure of G9a in complex with compound 11a
3K5K 1.7 Å, Discovery of a 2,4-Diamino-7-aminoalkoxy-quinazoline as a Potent Inhibitor of Histone…
5T0K 1.7 Å, Structure of G9a SET-domain with H3K9M mutant peptide and SAM

Browse structure collections

About this viewer

MolViewer shows 7DCF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.