7DDH: Na+,K+-ATPase

Crystal structures of Na+,K+-ATPase in complex with digoxin. Determined by X-ray diffraction at 3.46 Å resolution. Released 27 Jan 2021.

Method: X-ray diffraction
Resolution: 3.46 Å
Organism: Sus scrofa
Chains: 6
Atoms: 21,344
Mol. weight: 323.44 kDa
Ligands: MG, CLR, PCW, NAG
Released: 27 Jan 2021

Explore 7DDH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DDH contains 133 α-helices and 108 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 55 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	23-30	8
α-helix	32-33	2
α-helix	41-48	8
β-strand	51	1	1
β-strand	55	1	1
β-strand	56	1	2
α-helix	58-68	11
α-helix	73-76	4
α-helix	81-88	8
α-helix	93-112	20
α-helix	121-149	29
β-strand	161-166	6	2
β-strand	169-174	6	2
α-helix	175-177	3
β-strand	183-186	4	2
α-helix	190	1
β-strand	191	1	2
α-helix	192	1
β-strand	195-207	13	2
β-strand	218-219	2	2
β-strand	235-236	2	2
β-strand	241-253	13	2
α-helix	255-257	3
α-helix	259-268	10
α-helix	276-306	31
α-helix	310-323	14
α-helix	329-346	18
β-strand	350-351	2	3
α-helix	356-359	4
β-strand	365-368	4	3
α-helix	370-374	5
β-strand	375	1	4
β-strand	380-385	6	5
β-strand	390-392	3	5
α-helix	402-404	3
α-helix	409-420	12
β-strand	424-425	2	6
β-strand	441-442	2	6
α-helix	444-456	13
α-helix	461-465	5
β-strand	469-473	5	5
β-strand	481-486	6	5
β-strand	496-502	7	5
α-helix	504-508	5
β-strand	511-517	7	5
β-strand	519-521	3	5
α-helix	525-540	16
β-strand	544-553	10	5
α-helix	554	1
β-strand	576-585	10	5
α-helix	587	1
β-strand	588	1	4
α-helix	589	1
α-helix	592-602	11
β-strand	605-609	5	3
α-helix	614-624	11
β-strand	629	1	7
β-strand	631	1	7
α-helix	634-641	8
α-helix	650-652	3
β-strand	655-659	5	3
α-helix	660-663	4
α-helix	668-676	9
β-strand	680-684	5	3
α-helix	688-699	12
β-strand	705-709	5	3
α-helix	712-714	3
α-helix	715-720	6
β-strand	723-727	5	3
α-helix	733-737	5
β-strand	741-743	3	3
α-helix	749-774	26
α-helix	776-788	13
α-helix	797-802	6
α-helix	803-807	5
α-helix	809-815	7
α-helix	828-831	4
α-helix	840-843	4
α-helix	844-850	7
α-helix	851-868	18
α-helix	873-876	4
α-helix	880-883	4
β-strand	891-892	2	8
β-strand	898-899	2	8
α-helix	901-931	31
α-helix	937-940	4
α-helix	945-963	19
α-helix	967-970	4
α-helix	978-982	5
α-helix	985-1004	20
α-helix	1009-1012	4

Chain B: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	9
β-strand	27	1	9
α-helix	29-59	31
α-helix	70-72	3
β-strand	76	1	10
β-strand	77-79	3	11
β-strand	87-90	4	12
α-helix	99-108	10
α-helix	109-111	3
β-strand	123-124	2	13
α-helix	146-147	2
β-strand	148-149	2	13
α-helix	153-155	3
β-strand	175-180	6	11
α-helix	181-182	2
β-strand	184	1	14
α-helix	190-192	3
β-strand	208-210	3	15
β-strand	211-214	4	12
α-helix	220-223	4
β-strand	227-230	4	11
α-helix	232-234	3
β-strand	237-239	3	15
α-helix	240-242	3
β-strand	245	1	14
α-helix	247-250	4
β-strand	258-263	6	11
β-strand	272-278	7	12
β-strand	292	1	10
β-strand	296-301	6	12

Chain C: 54 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	23-30	8
α-helix	32-33	2
α-helix	41-48	8
β-strand	51	1	16
β-strand	55	1	16
β-strand	56	1	17
α-helix	58-68	11
α-helix	73-76	4
α-helix	81-88	8
α-helix	93-112	20
α-helix	121-149	29
β-strand	161-166	6	17
β-strand	169-174	6	17
α-helix	175-177	3
β-strand	183-186	4	17
α-helix	190	1
β-strand	191	1	17
α-helix	192	1
β-strand	195-207	13	17
β-strand	218-219	2	17
β-strand	235-236	2	17
β-strand	241-253	13	17
α-helix	255-257	3
α-helix	261-268	8
α-helix	276-306	31
α-helix	310-323	14
α-helix	329-346	18
β-strand	350-351	2	18
α-helix	356-359	4
β-strand	365-368	4	18
α-helix	370-374	5
β-strand	375	1	19
β-strand	380-385	6	20
β-strand	390-392	3	20
α-helix	402-404	3
α-helix	409-420	12
β-strand	425	1	21
β-strand	441	1	21
α-helix	444-456	13
α-helix	461-465	5
β-strand	469-473	5	20
β-strand	481-486	6	20
β-strand	496-502	7	20
α-helix	504-508	5
β-strand	511-517	7	20
β-strand	519-521	3	20
α-helix	525-540	16
β-strand	544-553	10	20
α-helix	554	1
β-strand	576-585	10	20
α-helix	587	1
β-strand	588	1	19
α-helix	589	1
α-helix	592-602	11
β-strand	605-609	5	18
α-helix	614-624	11
β-strand	629	1	22
β-strand	631	1	22
α-helix	634-641	8
α-helix	650-652	3
β-strand	655-659	5	18
α-helix	660-663	4
α-helix	668-676	9
β-strand	680-684	5	18
α-helix	688-699	12
β-strand	705-709	5	18
α-helix	712-714	3
α-helix	717-720	4
β-strand	723-727	5	18
α-helix	733-737	5
β-strand	741-743	3	18
α-helix	750-774	25
α-helix	776-788	13
α-helix	797-802	6
α-helix	803-807	5
α-helix	809-816	8
α-helix	828-831	4
α-helix	840-843	4
α-helix	844-850	7
α-helix	851-868	18
α-helix	880-883	4
β-strand	891-892	2	23
β-strand	898-899	2	23
α-helix	901-931	31
α-helix	937-940	4
α-helix	945-960	16
α-helix	967-970	4
α-helix	978-982	5
α-helix	985-1004	20
α-helix	1009-1014	6

Chain D: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	24
β-strand	27	1	24
α-helix	29-59	31
α-helix	70-72	3
β-strand	76	1	25
β-strand	77-79	3	26
β-strand	87-90	4	27
α-helix	99-109	11
β-strand	123-124	2	28
β-strand	148-149	2	28
α-helix	153-155	3
β-strand	175-180	6	26
α-helix	181-182	2
β-strand	184	1	29
α-helix	190-192	3
β-strand	208-210	3	30
β-strand	211-214	4	27
α-helix	220-223	4
β-strand	227-230	4	26
α-helix	232-234	3
β-strand	237-239	3	30
α-helix	240-242	3
β-strand	245	1	29
α-helix	247-250	4
β-strand	258-263	6	26
β-strand	272-278	7	27
β-strand	292	1	25
β-strand	296-301	6	27

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	23-45	23

Chain G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	23-44	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/potassium-transporting ATPase subunit alpha-1	A, C	protein	1016	Sus scrofa	P05024 (AlphaFold model)
Sodium/potassium-transporting ATPase subunit beta-1	B, D	protein	303	Sus scrofa	P05027 (AlphaFold model)
FXYD domain-containing ion transport regulator	E, G	protein	65	Sus scrofa	Q58K79 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7DDH_1 Sodium/potassium-transporting ATPase subunit alpha-1 (chains A, C)
GRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTPAR
AAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQAATEEEPQN
DNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVV
GDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFST
NCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFLGVSFF
ILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETL
GSTSTICSDKTGTLTQNRMTVAHMWSDNQIHEADTTENQSGVSFDKTSATWLALSRIAGL
CNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYTKIVEIPFNSTNK
YQLSIHKNPNTAEPRHLLVMKGAPERILDRCSSILIHGKEQPLDEELKDAFQNAYLELGG
LGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPLDNLCFVGLISMIDPPRAAVPDAVGKCR
SAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHG
SDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPASKK
ADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEI
TPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNE
QLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVNWDDRWINDVEDSYGQQWT
YEQRKIVEFTCHTPFFVTIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAF
LSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY

Sequence of entity 2 (B, D), FASTA

>7DDH_2 Sodium/potassium-transporting ATPase subunit beta-1 (chains B, D)
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDD
MIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKL
NRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPL
QYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS

Sequence of entity 3 (E, G), FASTA

>7DDH_3 FXYD domain-containing ion transport regulator (chains E, G)
MAGLSTDDGGSPKGDVDPFYYDYETVRNGGLIFAALAFIVGLIIILSKRLRCGGKKHRPI
NEDEL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
CLR	Cholesterol	C27 H46 O	6
PCW	1,2-dioleoyl-sn-glycero-3-phosphocholine	C44 H85 N O8 P	10
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
DGX	Digoxin	C41 H64 O14	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Binding of cardiotonic steroids to Na + ,K + -ATPase in the E2P state. Kanai, R., Cornelius, F., Ogawa, H. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2020438118 · PubMed

Other PDB entries of the same protein (UniProt P05024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WGU 2.8 Å, Crystal structure of a Na+-bound Na+,K+-ATPase preceding the E1P state without oligomycin
3WGV 2.8 Å, Crystal structure of a Na+-bound Na+,K+-ATPase preceding the E1P state with oligomycin
8JBK 2.8 Å, Crystal structure of Na+,K+-ATPase in the E1.3Na+ state
7WYT 2.9 Å, Crystal structures of Na+,K+-ATPase in complex with ouabain
8JBM 2.9 Å, Crystal structure of Na+,K+-ATPase in the E1.Mn2+ state
8JBL 3.0 Å, Crystal structure of Na+,K+-ATPase in the E1.Mg2+ state
7DDL 3.2 Å, Crystal structures of Na+,K+-ATPase in complex with bufalin
7D91 3.35 Å, Crystal Structure of the Na+,K+-ATPase in the E2P state with bound Mg2+ (P4(3)2(1)2…
4HYT 3.4 Å, Na,K-ATPase in the E2P state with bound ouabain and Mg2+ in the cation-binding site
4RES 3.41 Å, Crystal structure of the Na,K-ATPase E2P-bufalin complex with bound potassium
3B8E 3.5 Å, Crystal structure of the sodium-potassium pump
3KDP 3.5 Å, Crystal structure of the sodium-potassium pump

Browse structure collections

About this viewer

MolViewer shows 7DDH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.