crystal structure of Arabidopsis RDM15 tudor domain in complex with an H3K4me1 peptide. Determined by X-ray diffraction at 1.71 Å resolution. Released 7 Apr 2021.
Explore 7DE9 in 3D Show helices and sheets RCSB PDB PDBe
7DE9 contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 605-607 | 3 | |
| β-strand | 611-616 | 6 | 1 |
| β-strand | 621-631 | 11 | 1 |
| β-strand | 636-641 | 6 | 1 |
| β-strand | 646-649 | 4 | 1 |
| α-helix | 651-653 | 3 | |
| β-strand | 656-658 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional regulator | A | protein | 66 | Arabidopsis thaliana | Q8GUP3 (AlphaFold model) |
| Histone H3.2 | P | protein | 15 | Arabidopsis thaliana | P59226 (AlphaFold model) |
>7DE9_1 Transcriptional regulator (chains A) SLGQGKASGESLVGSRIKVWWPMDQAYYKGVVESYDAAKKKHLVIYDDGDQEILYLKNQK WSPLDE
>7DE9_2 Histone H3.2 (chains P) ARTKQTARKSTGGKA
A histone H3K4me1-specific binding protein is required for siRNA accumulation and DNA methylation at a subset of loci targeted by RNA-directed DNA methylation. Niu, Q., Song, Z., Tang, K. et al. Nat Commun (2021) 12:3367-3367. DOI 10.1038/s41467-021-23637-4 · PubMed
MolViewer shows 7DE9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.