7E20: PDB entry 7E20

Cryo EM structure of a K+-bound Na+,K+-ATPase in the E2 state. Determined by electron microscopy at 2.7 Å resolution. Released 15 Jun 2022.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,694
Mol. weight: 159.91 kDa
Ligands: MG, Y01, PC1, NAG
Released: 15 Jun 2022

Explore 7E20 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7E20 contains 68 α-helices and 53 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 57 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	31-34	4
α-helix	50-54	5
β-strand	58	1	1
β-strand	62	1	1
β-strand	63	1	2
α-helix	65-75	11
α-helix	82-84	3
α-helix	88-93	6
α-helix	95-97	3
α-helix	100-119	20
α-helix	128-149	22
α-helix	157-161	5
β-strand	168	1	3
β-strand	171-173	3	2
β-strand	176-178	3	2
β-strand	181	1	3
α-helix	182-184	3
β-strand	190-194	5	2
α-helix	197-199	3
β-strand	202-208	7	2
β-strand	211-214	4	4
α-helix	216-219	4
β-strand	225-227	3	4
β-strand	242-243	2	2
β-strand	248-249	2	4
β-strand	253-260	8	2
α-helix	262-264	3
α-helix	266-276	11
α-helix	283-305	23
α-helix	309-312	4
α-helix	317-329	13
α-helix	336-352	17
β-strand	356-358	3	5
α-helix	363-366	4
β-strand	372-376	5	5
α-helix	377-381	5
β-strand	382	1	6
β-strand	387-391	5	7
α-helix	397	1
β-strand	398-399	2	7
α-helix	416-427	12
β-strand	433	1	8
α-helix	442-444	3
β-strand	447	1	8
α-helix	451-463	13
α-helix	468-473	6
β-strand	476-480	5	7
β-strand	488-493	6	7
β-strand	504-509	6	7
α-helix	511-514	4
β-strand	521-523	3	9
β-strand	526-528	3	9
α-helix	532-546	15
β-strand	551-558	8	7
β-strand	587-592	6	7
β-strand	595	1	6
α-helix	599-608	10
α-helix	611	1
β-strand	612-616	5	5
α-helix	621-631	11
α-helix	641-647	7
α-helix	652-654	3
β-strand	662-666	5	5
α-helix	668-671	4
α-helix	675-684	10
β-strand	687-691	5	5
α-helix	695-707	13
β-strand	712-716	5	5
α-helix	719-721	3
α-helix	722-727	6
β-strand	730-734	5	5
β-strand	748-750	3	5
α-helix	756-781	26
α-helix	784-795	12
α-helix	805-809	5
α-helix	810-814	5
α-helix	816-820	5
α-helix	821-824	4
α-helix	831-833	3
α-helix	835-838	4
α-helix	847-850	4
α-helix	851-857	7
α-helix	858-876	19
α-helix	887-891	5
β-strand	898-899	2	10
β-strand	905-906	2	10
α-helix	908-936	29
α-helix	944-947	4
α-helix	952-970	19
α-helix	974-977	4
α-helix	982-984	3
α-helix	985-989	5
α-helix	992-1011	20
α-helix	1016-1021	6

Chain B: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	11
β-strand	27	1	11
α-helix	29-58	30
α-helix	70-72	3
β-strand	76	1	12
β-strand	77-79	3	13
β-strand	87-90	4	14
α-helix	99-108	10
α-helix	114-116	3
β-strand	123-124	2	15
α-helix	146-147	2
β-strand	148-149	2	15
α-helix	153-156	4
α-helix	169-171	3
β-strand	175-180	6	13
α-helix	190-193	4
β-strand	208-210	3	16
β-strand	211-215	5	14
β-strand	227-230	4	13
β-strand	237-239	3	16
α-helix	240-242	3
β-strand	259-263	5	13
α-helix	266-267	2
β-strand	272-278	7	14
β-strand	292	1	12
β-strand	294-301	8	14

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	23-45	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/potassium-transporting ATPase subunit alpha-1	A	protein	1023	Homo sapiens	P05023 (AlphaFold model)
Sodium/potassium-transporting ATPase subunit beta-1	B	protein	303	Homo sapiens	P05026 (AlphaFold model)
Sodium/potassium-transporting ATPase subunit gamma	C	protein	66	Homo sapiens	P54710 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7E20_1 Sodium/potassium-transporting ATPase subunit alpha-1 (chains A)
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY

Sequence of entity 2 (B), FASTA

>7E20_2 Sodium/potassium-transporting ATPase subunit beta-1 (chains B)
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD
MIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKL
NRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS

Sequence of entity 3 (C), FASTA

>7E20_3 Sodium/potassium-transporting ATPase subunit gamma (chains C)
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
Y01	Cholesterol hemisuccinate	C31 H50 O4	6
PC1	1,2-diacyl-sn-glycero-3-phosphocholine	C44 H88 N O8 P	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (K) are not listed.

Primary citation

Cryo-EM structures of recombinant human sodium-potassium pump determined in three different states. Guo, Y., Zhang, Y., Yan, R. et al. Nat Commun (2022) 13:3957-3957. DOI 10.1038/s41467-022-31602-y · PubMed

Other PDB entries of the same protein (UniProt P05023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9WAJ 2.39 Å, Cryo-EM structure of a human sodium pump wildtype in ouabain-bound E2P state
24RC 2.61 Å, Cryo-EM structure of human sodium pump W931R mutant in K+-occluded E2-Pi state
9WAK 2.86 Å, Cryo-EM structure of a human sodium pump W931R mutant in ouabain-bound E2P state
7E21 2.9 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state with ATP-gamma-S
9KCI 2.9 Å, Cryo-EM structure of human sodium pump WT in (2K+)E2-AlF state
9KCK 2.9 Å, Cryo-EM structure of human sodium pump E1003K in (2K+)E2-AlF state
9KCL 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 in (2Na+)E1-AMPPCP…
9KCM 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 and TMX2 in…
9KCG 3.1 Å, Cryo-EM structure of human sodium pump WT in (3Na+)E1-AMPPCP state
9KCJ 3.1 Å, Cryo-EM structure of human sodium pump E1003 in (3Na+)E1-AMPPCP state
7E1Z 3.2 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state
9KCR 3.2 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 in (2Na+)E1 state

Browse structure collections

About this viewer

MolViewer shows 7E20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.