7E40: Protein PHOSPHATE STARVATION RESPONSE 2

Mechanism of Phosphate Sensing and Signaling Revealed by Rice SPX1-PHR2 Complex Structure. Determined by X-ray diffraction at 2.6 Å resolution. Released 10 Nov 2021.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Oryza sativa subsp. japonica, Enterobacteria phage T4
Chains: 4
Atoms: 7,318
Mol. weight: 114.75 kDa
Ligands: IHP
Released: 10 Nov 2021

Explore 7E40 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7E40 contains 45 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	253-265	13
α-helix	274-281	8
α-helix	288-301	14
α-helix	331-374	44

Chain B: 18 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
α-helix	16-18	3
α-helix	25-32	8
α-helix	67-108	42
α-helix	114-156	43
α-helix	161-168	8
α-helix	172-175	4
α-helix	179-193	15
α-helix	198-203	6
α-helix	204-208	5
β-strand	210-211	2	1
β-strand	212	1	2
β-strand	213-215	3	1
β-strand	221-224	4	1
β-strand	227-230	4	1
α-helix	235-246	12
β-strand	253	1	2
α-helix	256-275	20
α-helix	281-286	6
α-helix	289-308	20
α-helix	311-318	8
α-helix	322-329	8
α-helix	333-337	5
α-helix	339-351	13

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	253-265	13
α-helix	274-281	8
α-helix	288-302	15
α-helix	334-373	40

Chain D: 19 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	22-24	3
α-helix	25-32	8
α-helix	67-107	41
α-helix	114-156	43
α-helix	161-168	8
α-helix	172-175	4
α-helix	177-192	16
α-helix	194-196	3
α-helix	198-206	9
β-strand	210-211	2	3
β-strand	212	1	4
β-strand	213-215	3	3
β-strand	221-224	4	3
β-strand	227-228	2	3
α-helix	235-246	12
β-strand	253	1	4
α-helix	256-276	21
α-helix	281-286	6
α-helix	289-302	14
α-helix	304-307	4
α-helix	311-318	8
α-helix	322-329	8
α-helix	333-337	5
α-helix	339-351	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein PHOSPHATE STARVATION RESPONSE 2	A, C	protein	134	Oryza sativa subsp. japonica	Q6Z156 (AlphaFold model)
SPX domain-containing protein 1,Endolysin	B, D	protein	358	Oryza sativa subsp. japonica, Enterobacteria phage T4	D9IEF7, Q69XJ0 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7E40_1 Protein PHOSPHATE STARVATION RESPONSE 2 (chains A, C)
SRMRWTPELHERFVDAMNLLGGSEKATPKGVMKLMKADNLTIYHVKSHMQKYRTARYRPE
LSEGSSEKKAASKEDIPSIDLKGGNFDLTEALRMQLELQKRLHEQLEIQRSLQLRIEEQG
KCLQMMLEQQCIPG

Sequence of entity 2 (B, D), FASTA

>7E40_2 SPX domain-containing protein 1,Endolysin (chains B, D)
SMKFGKSLSSQIVETLPEWRDKFLSYKDLKKRLKLIGGGGGGEERQAKRARVAADGGEEE
AAAAAMTPEEAGFMRLLEAELDKFNSFFVEKEEEYIIRQKELQDRVARAAGRESKEELMR
VRKEIVDFHGEMVLLENYSALNYTGLVKILKKYDKRTGALIRLPFIQKVLQQPFFTTDLL
YKLVKQCEAMLDQLLPSNEIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAK
SELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMV
FQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY

Ligands and cofactors

ID	Name	Formula	Copies
IHP	Inositol hexakisphosphate	C6 H18 O24 P6	3

Primary citation

Mechanism of phosphate sensing and signaling revealed by rice SPX1-PHR2 complex structure. Zhou, J., Hu, Q., Xiao, X. et al. Nat Commun (2021) 12:7040-7040. DOI 10.1038/s41467-021-27391-5 · PubMed

Other PDB entries of the same protein (UniProt Q6Z156 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D3Y 3.11 Å, Crystal structure of the osPHR2-osSPX2 complex

Browse structure collections

About this viewer

MolViewer shows 7E40 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.