crystal structure of maize SHH2 SAWADEE domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Jun 2021.
Explore 7EEZ in 3D Show helices and sheets RCSB PDB PDBe
7EEZ contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 136-139 | 4 | 1 |
| β-strand | 146-148 | 3 | 1 |
| β-strand | 149-156 | 8 | 2 |
| α-helix | 158-160 | 3 | |
| β-strand | 164-169 | 6 | 2 |
| β-strand | 178-181 | 4 | 2 |
| α-helix | 182-185 | 4 | |
| β-strand | 186-188 | 3 | 1 |
| α-helix | 189-190 | 2 | |
| β-strand | 191-192 | 2 | 3 |
| α-helix | 193-194 | 2 | |
| α-helix | 195-200 | 6 | |
| β-strand | 206-212 | 7 | 3 |
| β-strand | 217-228 | 12 | 3 |
| β-strand | 233 | 1 | 4 |
| β-strand | 236 | 1 | 4 |
| β-strand | 240-245 | 6 | 3 |
| β-strand | 251-255 | 5 | 3 |
| α-helix | 256-258 | 3 | |
| β-strand | 259-261 | 3 | 3 |
| α-helix | 263-270 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| HB transcription factor | A | protein | 158 | Zea mays | B7ZYP9 (AlphaFold model) |
>7EEZ_1 HB transcription factor (chains A) SGKNPVESVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWINVR KCVRQRSLPCEATECVAVLPGDLILCFQEGKDQALYYDAHVLDAQRRRHDVRGCRCRFLV RYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAATN
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Recognition of H3K9me1 by maize RNA-directed DNA methylation factor SHH2. Wang, Y., Zhou, X., Luo, J. et al. J Integr Plant Biol (2021) 63:1091-1096. DOI 10.1111/jipb.13103 · PubMed
Other PDB entries of the same protein (UniProt B7ZYP9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7EEZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.