7EEZ: Maize SHH2 SAWADEE domain

crystal structure of maize SHH2 SAWADEE domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Jun 2021.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Zea mays
Chains: 1
Atoms: 1,208
Mol. weight: 18.17 kDa
Ligands: ZN
Released: 30 Jun 2021

Explore 7EEZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EEZ contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	136-139	4	1
β-strand	146-148	3	1
β-strand	149-156	8	2
α-helix	158-160	3
β-strand	164-169	6	2
β-strand	178-181	4	2
α-helix	182-185	4
β-strand	186-188	3	1
α-helix	189-190	2
β-strand	191-192	2	3
α-helix	193-194	2
α-helix	195-200	6
β-strand	206-212	7	3
β-strand	217-228	12	3
β-strand	233	1	4
β-strand	236	1	4
β-strand	240-245	6	3
β-strand	251-255	5	3
α-helix	256-258	3
β-strand	259-261	3	3
α-helix	263-270	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HB transcription factor	A	protein	158	Zea mays	B7ZYP9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7EEZ_1 HB transcription factor (chains A)
SGKNPVESVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWINVR
KCVRQRSLPCEATECVAVLPGDLILCFQEGKDQALYYDAHVLDAQRRRHDVRGCRCRFLV
RYDHDSSEEIVPLRKVCRRPETDYRLQILHAARAAATN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Recognition of H3K9me1 by maize RNA-directed DNA methylation factor SHH2. Wang, Y., Zhou, X., Luo, J. et al. J Integr Plant Biol (2021) 63:1091-1096. DOI 10.1111/jipb.13103 · PubMed

Other PDB entries of the same protein (UniProt B7ZYP9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EF0 1.5 Å, Crystal structure of maize SHH2 SAWADEE domain in complex with an H3K9M peptide
7EF1 1.9 Å, crystal structure of maize SHH2 SAWADEE domain in complex with and H3K9me1 peptide
7EF2 2.0 Å, Crystal structure of maize SHH2 SAWADEE domain in complex with an H3K9me3 peptide
7EF3 2.1 Å, crystal structure of maize SHH2 SAWADEE domain in complex with H3K9me2 peptide

Browse structure collections

About this viewer

MolViewer shows 7EEZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.