7EG2: ApoAequorin complex with (S)-daCTZ

Crystal structure of the apoAequorin complex with (S)-daCTZ. Determined by X-ray diffraction at 2.22 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 2.22 Å
Organism: Aequorea victoria
Chains: 16
Atoms: 26,432
Mol. weight: 367.91 kDa
Ligands: J2X
Released: 23 Jun 2021

Explore 7EG2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EG2 contains 173 α-helices and 72 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	-1	1	1
α-helix	10-23	14
β-strand	30-32	3	2
α-helix	33-46	14
α-helix	52-68	17
β-strand	76-78	3	2
α-helix	79-98	20
α-helix	101-103	3
α-helix	104-116	13
β-strand	123-124	2	3
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	3
α-helix	162-169	8
α-helix	170-175	6
α-helix	178-180	3

Chain B: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	-1	1	4
α-helix	10-23	14
β-strand	30-32	3	5
α-helix	33-46	14
α-helix	52-68	17
β-strand	76-78	3	5
α-helix	79-98	20
α-helix	101-103	3
α-helix	104-116	13
β-strand	123-124	2	6
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	6
α-helix	162-169	8
α-helix	170-174	5
α-helix	178-180	3

Chain C: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-23	14
β-strand	30-32	3	7
α-helix	33-46	14
α-helix	52-67	16
β-strand	76-78	3	7
α-helix	79-98	20
α-helix	101-103	3
α-helix	104-116	13
β-strand	123-124	2	8
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	8
α-helix	162-169	8
α-helix	170-175	6
α-helix	178-180	3

Chain D: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	9
α-helix	10-23	14
β-strand	30-32	3	10
α-helix	33-46	14
α-helix	52-67	16
β-strand	76-78	3	10
α-helix	79-98	20
α-helix	101-103	3
α-helix	104-116	13
β-strand	123-124	2	11
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	11
α-helix	162-169	8
α-helix	170-175	6
α-helix	178-180	3

Chain E: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	-1	1	12
α-helix	10-23	14
β-strand	30-32	3	13
α-helix	33-46	14
α-helix	52-67	16
β-strand	76-78	3	13
α-helix	79-98	20
α-helix	101-103	3
α-helix	104-116	13
β-strand	123-124	2	14
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	14
α-helix	162-169	8
α-helix	170-175	6
α-helix	178-180	3

Chain F: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-23	14
β-strand	30-32	3	15
α-helix	33-42	10
α-helix	43-47	5
α-helix	52-68	17
β-strand	76-78	3	15
α-helix	79-98	20
α-helix	101-103	3
α-helix	104-116	13
β-strand	123-124	2	16
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	16
α-helix	162-169	8
α-helix	170-175	6
α-helix	178-180	3

Chain G: 10 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
α-helix	10-23	14
β-strand	30-32	3	17
α-helix	33-46	14
α-helix	52-67	16
β-strand	76-78	3	17
α-helix	79-98	20
α-helix	104-116	13
β-strand	123-124	2	18
α-helix	126-136	11
α-helix	142-151	10
β-strand	160-161	2	18
α-helix	162-169	8
α-helix	170-175	6
α-helix	178-180	3

Chain H: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	4
α-helix	10-23	14
β-strand	30-32	3	19
α-helix	33-46	14
α-helix	52-68	17
β-strand	76-78	3	19
α-helix	79-98	20
α-helix	101-103	3
α-helix	104-116	13
β-strand	123-124	2	20
α-helix	126-136	11
α-helix	144-151	8
β-strand	160-161	2	20
α-helix	162-169	8
α-helix	170-174	5
α-helix	178-180	3

6 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aequorin-2	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P	protein	198	Aequorea victoria	P02592 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P), FASTA

>7EG2_1 Aequorin-2 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P)
ANSHHHHHHGKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGAT
PEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDA
LFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLG
FWYTMDPACEKLYGGAVP

Ligands and cofactors

ID	Name	Formula	Copies
J2X	(2~{S})-2-(hydroxymethyl)-6-(4-hydroxyphenyl)-2-[(4-hydroxyphenyl)methyl]-4-(ph…	C30 H26 O4	16

Primary citation

Chiral deaza-coelenterazine analogs for probing a substrate-binding site in the Ca2+-binding photoprotein aequorin. Inouye, S., Sumida, Y., Tomabechi, Y. et al. PLoS One (2021) 16:e0251743-e0251743. DOI 10.1371/journal.pone.0251743 · PubMed

Other PDB entries of the same protein (UniProt P02592 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UHK 1.6 Å, Crystal structure of n-aequorin
1UHH 1.8 Å, Crystal structure of cp-aequorin
1UHI 1.8 Å, Crystal structure of i-aequorin
1UHJ 1.8 Å, Crystal structure of br-aequorin
7EG3 2.09 Å, Crystal structure of the apoAequorin complex with (S)-HM-daCTZ
5ZAB 2.15 Å, Crystal structure of cf3-aequorin
1EJ3 2.3 Å, Crystal structure of aequorin

Browse structure collections

About this viewer

MolViewer shows 7EG2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.