7EMB: Leucocyte antigen

Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African Swine Fever Virus-Derived T Cell Epitopes Presented by Swine Major Histocompatibility Complex Class I. Determined by X-ray diffraction at 1.97 Å resolution. Released 8 Dec 2021.

Method: X-ray diffraction
Resolution: 1.97 Å
Organisms: Sus scrofa, uncultured virus
Chains: 3
Atoms: 3,214
Mol. weight: 44.49 kDa
Released: 8 Dec 2021

Explore 7EMB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EMB contains 15 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	1
β-strand	19-28	10	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	1
α-helix	104	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-161	10
α-helix	163-174	12
α-helix	176-179	4
β-strand	183	1	2
α-helix	184-185	2
β-strand	186-193	8	3
β-strand	199-208	10	3
β-strand	209	1	2
β-strand	214-219	6	4
β-strand	222-223	2	4
β-strand	228-230	3	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-249	9	3
α-helix	254-256	3
β-strand	257-262	6	4
α-helix	269	1
β-strand	270-272	3	4

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	5
α-helix	4-5	2
β-strand	6-11	6	6
β-strand	21-30	10	6
β-strand	31	1	5
β-strand	36-41	6	7
β-strand	44-45	2	7
α-helix	46	1
β-strand	49-50	2	6
α-helix	51-53	3
β-strand	54-55	2	6
β-strand	61-69	9	6
β-strand	77-82	6	7
β-strand	90-93	4	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucocyte antigen	A	protein	275	Sus scrofa	O19075 (AlphaFold model)
Beta-2-microglobulin	B	protein	100	Sus scrofa	Q07717 (AlphaFold model)
Ala-ala-ala-ile-glu-glu-glu-asp-ile	C	protein	9	uncultured virus

Sequence of entity 1 (A), FASTA

>7EMB_1 Leucocyte antigen (chains A)
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPRMEPRAPWIQQEGQDYW
DRETRKQRDTSQTYRVGLKNLRGYYNQSEAGSHTYQSMYGCYLGPDGLLLRGYRQYAYDG
ADYIALNEDLRSWTAADTAAQITKRKWETANVAERRRSYLQGLCVESLREYLEMGKDTLQ
RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGT
FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B), FASTA

>7EMB_2 Beta-2-microglobulin (chains B)
EFVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKD
WSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C), FASTA

>7EMB_3 ALA-ALA-ALA-ILE-GLU-GLU-GLU-ASP-ILE (chains C)
AAAIEEEDI

Primary citation

Mooring Stone-Like Arg 114 Pulls Diverse Bulged Peptides: First Insight into African Swine Fever Virus-Derived T Cell Epitopes Presented by Swine Major Histocompatibility Complex Class I. Yue, C., Xiang, W., Huang, X. et al. J Virol (2022) 96:e0137821-e0137821. DOI 10.1128/JVI.01378-21 · PubMed

Other PDB entries of the same protein (UniProt O19075 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EMD 1.7 Å, Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African…
7EMA 1.8 Å, Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African…
7EM9 1.9 Å, Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African…
7EMC 1.9 Å, Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African…

Browse structure collections

About this viewer

MolViewer shows 7EMB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.