Mooring Stone-Like Arg114 Pulls Diverse Bulged Peptides: First Insight into African Swine Fever Virus-Derived T Cell Epitopes Presented by Swine Major Histocompatibility Complex Class I. Determined by X-ray diffraction at 1.97 Å resolution. Released 8 Dec 2021.
Explore 7EMB in 3D Show helices and sheets RCSB PDB PDBe
7EMB contains 15 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-14 | 11 | 1 |
| β-strand | 19-28 | 10 | 1 |
| β-strand | 31-37 | 7 | 1 |
| β-strand | 46-47 | 2 | 1 |
| α-helix | 50-54 | 5 | |
| α-helix | 57-84 | 28 | |
| β-strand | 94-103 | 10 | 1 |
| α-helix | 104 | 1 | |
| β-strand | 109-118 | 10 | 1 |
| β-strand | 121-126 | 6 | 1 |
| β-strand | 133-135 | 3 | 1 |
| α-helix | 138-149 | 12 | |
| α-helix | 152-161 | 10 | |
| α-helix | 163-174 | 12 | |
| α-helix | 176-179 | 4 | |
| β-strand | 183 | 1 | 2 |
| α-helix | 184-185 | 2 | |
| β-strand | 186-193 | 8 | 3 |
| β-strand | 199-208 | 10 | 3 |
| β-strand | 209 | 1 | 2 |
| β-strand | 214-219 | 6 | 4 |
| β-strand | 222-223 | 2 | 4 |
| β-strand | 228-230 | 3 | 3 |
| α-helix | 231-233 | 3 | |
| β-strand | 234-235 | 2 | 3 |
| β-strand | 241-249 | 9 | 3 |
| α-helix | 254-256 | 3 | |
| β-strand | 257-262 | 6 | 4 |
| α-helix | 269 | 1 | |
| β-strand | 270-272 | 3 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 5 |
| α-helix | 4-5 | 2 | |
| β-strand | 6-11 | 6 | 6 |
| β-strand | 21-30 | 10 | 6 |
| β-strand | 31 | 1 | 5 |
| β-strand | 36-41 | 6 | 7 |
| β-strand | 44-45 | 2 | 7 |
| α-helix | 46 | 1 | |
| β-strand | 49-50 | 2 | 6 |
| α-helix | 51-53 | 3 | |
| β-strand | 54-55 | 2 | 6 |
| β-strand | 61-69 | 9 | 6 |
| β-strand | 77-82 | 6 | 7 |
| β-strand | 90-93 | 4 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leucocyte antigen | A | protein | 275 | Sus scrofa | O19075 (AlphaFold model) |
| Beta-2-microglobulin | B | protein | 100 | Sus scrofa | Q07717 (AlphaFold model) |
| Ala-ala-ala-ile-glu-glu-glu-asp-ile | C | protein | 9 | uncultured virus |
>7EMB_1 Leucocyte antigen (chains A) GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPRMEPRAPWIQQEGQDYW DRETRKQRDTSQTYRVGLKNLRGYYNQSEAGSHTYQSMYGCYLGPDGLLLRGYRQYAYDG ADYIALNEDLRSWTAADTAAQITKRKWETANVAERRRSYLQGLCVESLREYLEMGKDTLQ RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGT FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD
>7EMB_2 Beta-2-microglobulin (chains B) EFVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKD WSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH
>7EMB_3 ALA-ALA-ALA-ILE-GLU-GLU-GLU-ASP-ILE (chains C) AAAIEEEDI
Mooring Stone-Like Arg 114 Pulls Diverse Bulged Peptides: First Insight into African Swine Fever Virus-Derived T Cell Epitopes Presented by Swine Major Histocompatibility Complex Class I. Yue, C., Xiang, W., Huang, X. et al. J Virol (2022) 96:e0137821-e0137821. DOI 10.1128/JVI.01378-21 · PubMed
Other PDB entries of the same protein (UniProt O19075 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7EMB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.