Crystal structure of hnRNP LL RRM2 in complex with SETD2. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Oct 2021.
Explore 7EVS in 3D Show helices and sheets RCSB PDB PDBe
7EVS contains 4 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 168-174 | 7 | 1 |
| α-helix | 182-189 | 8 | |
| β-strand | 195-203 | 9 | 1 |
| β-strand | 205-212 | 8 | 1 |
| α-helix | 215-225 | 11 | |
| β-strand | 229-231 | 3 | 1 |
| β-strand | 234-241 | 8 | 1 |
| β-strand | 256-258 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2188 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heterogeneous nuclear ribonucleoprotein L-like | A, B | protein | 110 | Homo sapiens | Q8WVV9 (AlphaFold model) |
| SHI domain from Histone-lysine N-methyltransferase SETD2 | C, D | protein | 13 | Homo sapiens | Q9BYW2 (AlphaFold model) |
>7EVS_1 Heterogeneous nuclear ribonucleoprotein L-like (chains A, B) HHHHHHMNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMVEFESVLCA QKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRD
>7EVS_2 SHI domain from Histone-lysine N-methyltransferase SETD2 (chains C, D) SNPNAGKVLLPTP
Structural basis of the interaction between SETD2 methyltransferase and hnRNP L paralogs for governing co-transcriptional splicing. Bhattacharya, S., Wang, S., Reddy, D. et al. Nat Commun (2021) 12:6452-6452. DOI 10.1038/s41467-021-26799-3 · PubMed
MolViewer shows 7EVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.