7F5M: Sas5 YEATS domain

Crystal structure of Sas5 YEATS domain in complex with H3K27bz peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Saccharomyces cerevisiae
Chains: 3
Atoms: 2,406
Mol. weight: 35.28 kDa
Released: 16 Mar 2022

Explore 7F5M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F5M contains 7 α-helices and 20 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-17	14	1
α-helix	18	1
α-helix	28-30	3
β-strand	31-40	10	1
β-strand	46-47	2	1
β-strand	52-58	7	2
β-strand	67-70	4	2
β-strand	76-81	6	1
β-strand	84	1	3
β-strand	85-93	9	2
α-helix	94-96	3
β-strand	99-106	8	2
β-strand	112-122	11	1
α-helix	126-132	7

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-14	10	4
β-strand	32-40	9	4
β-strand	46-47	2	4
β-strand	52-58	7	5
β-strand	67-70	4	5
β-strand	76-80	5	4
β-strand	86-93	8	5
β-strand	99-105	7	5
β-strand	112-121	10	4
α-helix	126-133	8

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	19-21	3
α-helix	22-25	4
β-strand	28	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Something about silencing protein 5	A, B	protein	139	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	Q99314 (AlphaFold model)
Lys-gln-leu-ala-ser-lys-ala-ala-arg-lbz-ser-ala-pro-ser-thr-gly-gly-val-lys-tyr	C	protein	20	Saccharomyces cerevisiae	P61830 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7F5M_1 Something about silencing protein 5 (chains A, B)
SDHSIEVTFRVKTQQVIIPEQNIRGNELPLRRWQMELLMLDATGKEVEPTILSKCIYHLH
SSFKQPKRRLNSLPFFIKETGWGEFNLKIECFFIGNAGKFSIEHDLTFEDDAYAVDYTVD
VPHEFSHLNSELSKYFDLP

Sequence of entity 2 (C), FASTA

>7F5M_2 LYS-GLN-LEU-ALA-SER-LYS-ALA-ALA-ARG-LBZ-SER-ALA-PRO-SER-THR-GLY-GLY-VAL-LYS-TYR (chains C)
KQLASKAARKSAPSTGGVKY

Primary citation

Global profiling of regulatory elements in the histone benzoylation pathway. Wang, D., Yan, F., Wu, P. et al. Nat Commun (2022) 13:1369-1369. DOI 10.1038/s41467-022-29057-2 · PubMed

Browse structure collections

About this viewer

MolViewer shows 7F5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.