7F64: EIF2B-SFSV NSs

eIF2B-SFSV NSs. Determined by electron microscopy at 2.42 Å resolution. Released 8 Dec 2021.

Method: Electron microscopy
Resolution: 2.42 Å
Organisms: Homo sapiens, Sandfly fever sicilian virus
Chains: 12
Atoms: 28,752
Mol. weight: 581.8 kDa
Released: 8 Dec 2021

Explore 7F64 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F64 contains 190 α-helices and 191 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	22-35	14
α-helix	46-59	14
α-helix	63-82	20
α-helix	86-115	30
α-helix	116-118	3
β-strand	124-126	3	1
α-helix	132-143	12
β-strand	149-153	5	1
α-helix	160-170	11
β-strand	175-178	4	1
α-helix	183-186	4
β-strand	192-196	5	1
β-strand	199-200	2	2
β-strand	206-209	4	2
α-helix	212-221	10
β-strand	226-229	4	1
α-helix	232-234	3
β-strand	235	1	2
α-helix	248-251	4
β-strand	273-276	4	2
α-helix	278-280	3
β-strand	283-286	4	1
β-strand	289-291	3	1
α-helix	293-303	11

Chain B: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	22-35	14
α-helix	46-59	14
α-helix	63-82	20
α-helix	86-105	20
α-helix	107-115	9
α-helix	116-118	3
α-helix	119-120	2
β-strand	124-127	4	3
α-helix	132-143	12
β-strand	149-153	5	3
α-helix	160-169	10
β-strand	175-178	4	3
α-helix	183-186	4
β-strand	192-195	4	3
β-strand	199-200	2	4
β-strand	206-209	4	4
α-helix	212-221	10
β-strand	226-229	4	3
α-helix	232-234	3
β-strand	235	1	4
α-helix	248-251	4
β-strand	273-276	4	4
α-helix	278-280	3
β-strand	283-286	4	3
β-strand	289-291	3	3
α-helix	293-303	11

Chain C: 21 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	31-48	18
α-helix	54-71	18
α-helix	76-97	22
α-helix	109-114	6
α-helix	129-145	17
α-helix	147-152	6
β-strand	164-168	5	5
α-helix	172-181	10
β-strand	188-192	5	5
α-helix	200-209	10
β-strand	213-217	5	5
α-helix	219-221	3
α-helix	222-225	4
α-helix	226-228	3
β-strand	231-234	4	5
β-strand	238-239	2	6
β-strand	245-248	4	6
α-helix	251-260	10
β-strand	265-268	4	5
α-helix	271-273	3
β-strand	274	1	6
β-strand	288	1	7
α-helix	291-293	3
α-helix	297-299	3
α-helix	301-304	4
β-strand	306-308	3	8
β-strand	311	1	7
β-strand	313-316	4	6
α-helix	318-320	3
β-strand	323-326	4	5
β-strand	329-331	3	5
α-helix	333-335	3
α-helix	336-343	8
α-helix	346-348	3

Chain D: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-24	16
α-helix	31-48	18
α-helix	54-71	18
α-helix	76-97	22
α-helix	109-114	6
α-helix	129-145	17
α-helix	147-152	6
β-strand	164-168	5	9
α-helix	172-181	10
β-strand	188-192	5	9
α-helix	200-209	10
β-strand	213-217	5	9
α-helix	219-221	3
α-helix	222-226	5
β-strand	231-234	4	9
β-strand	238-239	2	10
β-strand	245-248	4	10
α-helix	251-260	10
β-strand	265-268	4	9
α-helix	271-273	3
β-strand	274	1	10
β-strand	288	1	11
α-helix	291-293	3
α-helix	297-299	3
α-helix	301-304	4
β-strand	306-308	3	12
β-strand	311	1	11
β-strand	313-316	4	10
α-helix	318-320	3
β-strand	323-326	4	9
β-strand	329-331	3	9
α-helix	333-335	3
α-helix	336-343	8
α-helix	346-348	3

Chain E: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	13
α-helix	37-46	10
β-strand	50-55	6	13
α-helix	63-67	5
β-strand	74-79	6	13
α-helix	86-92	7
α-helix	94-96	3
β-strand	101-105	5	13
α-helix	115-123	9
β-strand	128-134	7	13
β-strand	156-160	5	14
β-strand	166	1	13
β-strand	167-172	6	14
β-strand	179-183	5	15
α-helix	184-189	6
β-strand	192-196	5	14
β-strand	199-207	9	13
α-helix	209-217	9
α-helix	224-228	5
α-helix	229-235	7
β-strand	263-268	6	13
α-helix	273-275	3
α-helix	278-280	3
α-helix	281-292	12

Chain F: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	16
α-helix	37-46	10
β-strand	51-55	5	16
α-helix	63-67	5
β-strand	75-79	5	16
α-helix	86-92	7
α-helix	94-96	3
β-strand	101-105	5	16
α-helix	115-123	9
β-strand	128-134	7	16
β-strand	156-160	5	17
β-strand	166	1	16
β-strand	167-172	6	17
β-strand	179-183	5	18
α-helix	184-189	6
β-strand	192-196	5	17
β-strand	199-207	9	16
α-helix	209-217	9
α-helix	224-228	5
α-helix	229-235	7
β-strand	263-268	6	16
α-helix	273-275	3
α-helix	278-280	3
α-helix	281-291	11

Chain G: 25 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	167-172	6
α-helix	175-177	3
α-helix	178-180	3
β-strand	185	1	19
α-helix	192-195	4
α-helix	205-215	11
α-helix	222-239	18
α-helix	242-243	2
α-helix	248-266	19
α-helix	268-270	3
α-helix	271-285	15
α-helix	293-308	16
α-helix	309-314	6
α-helix	315-324	10
β-strand	332-336	5	12
α-helix	340-352	13
β-strand	357-362	6	12
α-helix	369-379	11
β-strand	383-387	5	12
α-helix	388-390	3
α-helix	391-394	4
α-helix	395-397	3
β-strand	400-404	5	12
β-strand	407-408	2	20
β-strand	414-417	4	20
α-helix	420-429	10
β-strand	434-437	4	12
α-helix	440-442	3
β-strand	443	1	20
β-strand	457	1	19
α-helix	460-463	4
β-strand	467	1	21
β-strand	470	1	21
α-helix	476-478	3
β-strand	482-484	3	9
β-strand	487	1	19
β-strand	489-492	4	20
α-helix	494-496	3
β-strand	499-502	4	12
β-strand	505-507	3	12
α-helix	509-511	3
α-helix	512-520	9

Chain H: 25 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	167-172	6
α-helix	178-180	3
β-strand	185	1	22
α-helix	192-195	4
α-helix	205-215	11
α-helix	222-239	18
α-helix	242-243	2
α-helix	248-266	19
α-helix	268-270	3
α-helix	271-285	15
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-324	11
β-strand	332-336	5	8
α-helix	340-352	13
β-strand	357-362	6	8
α-helix	369-379	11
β-strand	383-387	5	8
α-helix	388-390	3
α-helix	391-394	4
α-helix	395-397	3
β-strand	400-404	5	8
β-strand	407-408	2	23
α-helix	413	1
β-strand	414-417	4	23
α-helix	420-429	10
β-strand	434-437	4	8
α-helix	440-442	3
β-strand	443	1	23
β-strand	457	1	22
α-helix	460-463	4
β-strand	467	1	24
β-strand	470	1	24
α-helix	476-478	3
β-strand	482-484	3	5
β-strand	487	1	22
β-strand	489-492	4	23
α-helix	494-496	3
β-strand	499-501	3	8
β-strand	506-507	2	8
α-helix	509-511	3
α-helix	512-520	9

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor eIF-2B subunit alpha	A, B	protein	305	Homo sapiens	Q14232 (AlphaFold model)
Translation initiation factor eIF-2B subunit beta	C, D	protein	351	Homo sapiens	P49770 (AlphaFold model)
Translation initiation factor eIF-2B subunit gamma	E, F	protein	452	Homo sapiens	Q9NR50 (AlphaFold model)
Translation initiation factor eIF-2B subunit delta	G, H	protein	523	Homo sapiens	Q9UI10 (AlphaFold model)
Translation initiation factor eIF-2B subunit epsilon	I, J	protein	721	Homo sapiens	Q13144
Non-structural protein NS-S	K, L	protein	261	Sandfly fever sicilian virus	P12792

Sequence of entity 1 (A, B), FASTA

>7F64_1 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL

Sequence of entity 2 (C, D), FASTA

>7F64_2 Translation initiation factor eIF-2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL

Sequence of entity 3 (E, F), FASTA

>7F64_3 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI

Sequence of entity 4 (G, H), FASTA

>7F64_4 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Sequence of entity 5 (I, J), FASTA

>7F64_5 Translation initiation factor eIF-2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D

Sequence of entity 6 (K, L), FASTA

>7F64_6 Non-structural protein NS-S (chains K, L)
MNSQYMFDYPAINIDVRCHRLLSSVSYVAYNKFHTHDVSTYEHCEIPLEKLRLGFGRRNS
LADFYSLGELPASWGPACYFSSVKPMMYTFQGMASDLSRFDLTSFSRKGLPNVLKALSWP
LGIPDCEIFSICSDRFVRGLQTRDQLMSYILRMGDSHSLDECIVQAHKKILQEARRLGLS
DEHYNGYDLFREIGSLVCLRLINAEPFDTASSGEALDVRTVIRSYRASDPSTGLTEYGNS
LWTPIHSHVDENDESSSDSDF

Primary citation

eIF2B-capturing viral protein NSs suppresses the integrated stress response. Kashiwagi, K., Shichino, Y., Osaki, T. et al. Nat Commun (2021) 12:7102-7102. DOI 10.1038/s41467-021-27337-x · PubMed

Other PDB entries of the same protein (UniProt Q14232 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9ZUZ 2.25 Å, Translation Initiation Factor eIF-2B complex with the Isohexide Diamine GSK735
7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
3ECS 2.65 Å, Crystal structure of human eIF2B alpha
7KMA 2.7 Å, Crystal structure of eif2Balpha with a ligand.
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
9Y5T 2.78 Å, eIF2B lacking the latch helix bound to ISRACT-02 (Active state)

Browse structure collections

About this viewer

MolViewer shows 7F64 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.