7FA1: Non-structural protein 2

Crystal Structure of N-terminus of the non-structural protein 2 from SARS coronavirus. Determined by X-ray diffraction at 1.6 Å resolution. Released 10 Aug 2022.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Severe acute respiratory syndrome-related coronavirus
Chains: 1
Atoms: 2,566
Mol. weight: 31.64 kDa
Ligands: ZN
Released: 10 Aug 2022

Explore 7FA1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7FA1 contains 12 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	1
β-strand	12	1	2
β-strand	18	1	2
α-helix	20-28	9
α-helix	36-45	10
α-helix	48-50	3
β-strand	58-65	8	1
α-helix	70-72	3
α-helix	75-77	3
β-strand	78-83	6	1
β-strand	100-104	5	1
α-helix	105-107	3
α-helix	113-115	3
α-helix	116-122	7
α-helix	130-132	3
β-strand	134-135	2	3
β-strand	138-143	6	4
β-strand	150-155	6	4
β-strand	159-161	3	4
β-strand	168-170	3	4
β-strand	176-177	2	4
β-strand	180	1	5
β-strand	185-186	2	3
β-strand	187-190	4	1
α-helix	192-195	4
α-helix	205-212	8
β-strand	217-219	3	6
β-strand	222-224	3	6
β-strand	225-227	3	1
β-strand	230-238	9	1
β-strand	241-251	11	1
β-strand	256	1	5
β-strand	260	1	4
α-helix	265-273	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-structural protein 2	A	protein	279	Severe acute respiratory syndrome-related coronavirus	P0C6X7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7FA1_1 Non-structural protein 2 (chains A)
GSMAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHDHE
IAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFM
GRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTC
GYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCY
NKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

The Life of SARS-CoV-2 Inside Cells: Replication-Transcription Complex Assembly and Function. Lou, Z., Rao, Z. Annu Rev Biochem (2022) 91:381-401. DOI 10.1146/annurev-biochem-052521-115653 · PubMed

Other PDB entries of the same protein (UniProt P0C6X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ACF 1.4 Å, NMR structure of SARS-CoV non-structural protein NSP3A (SARS1) from SARS coronavirus
6W79 1.46 Å, Structure of SARS-CoV main protease bound to potent broad-spectrum non-covalent…
6WCO 1.48 Å, Structure of SARS main protease bound to inhibitor X47
5C5O 1.5 Å, Structure of SARS-3CL protease complex with a phenyl-beta-alanyl (S,R)-N-decalin type…
8CB3 1.57 Å, SARS-CoV Macro domain complexed with 3-(N-morpholino)propanesulfonic acid
3TNT 1.59 Å, Crystal structure of SARS coronavirus main protease complexed with an alpha,…
4TWY 1.6 Å, Structure of SARS-3CL protease complex with a phenylbenzoyl (S,R)-N-decalin type inhibitor
5N19 1.62 Å, Structure of SARS coronavirus main protease in complex with the alpha-ketoamide…
2ZU5 1.65 Å, complex structure of SARS-CoV 3CL protease with TG-0205486
8UFM 1.65 Å, Crystal Structure of L516C/Y647C Mutant of SARS-Unique Domain (SUD) from SARS-CoV-2
3SZN 1.69 Å, Crystal structure of SARS coronavirus main protease complexed with an alpha,…
5C5N 1.69 Å, Structure of SARS-3CL protease complex with a phenyl-beta-alanyl (R,S)-N-decalin type…

Browse structure collections

About this viewer

MolViewer shows 7FA1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.