7FB5: FAM134B/GABARAP complex

Crystal structure of FAM134B/GABARAP complex. Determined by X-ray diffraction at 2.84 Å resolution. Released 23 Mar 2022.

Method: X-ray diffraction
Resolution: 2.84 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,142
Mol. weight: 16.91 kDa
Released: 23 Mar 2022

Explore 7FB5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7FB5 contains 8 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-65	9
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	455	1
β-strand	456-457	2	1
α-helix	458	1
α-helix	461-470	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein	A	protein	117	Mus musculus	Q9DCD6 (AlphaFold model)
Reticulophagy regulator 1	B	protein	26	Homo sapiens	Q9H6L5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7FB5_1 Gamma-aminobutyric acid receptor-associated protein (chains A)
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Sequence of entity 2 (B), FASTA

>7FB5_2 Reticulophagy regulator 1 (chains B)
EGDDFELLDQSELDQIESELGLTQDQ

Primary citation

The crystal structure of the FAM134B-GABARAP complex provides mechanistic insights into the selective binding of FAM134 to the GABARAP subfamily. Zhao, J., Li, Z., Li, J. FEBS Open Bio (2022) 12:320-331. DOI 10.1002/2211-5463.13340 · PubMed

Other PDB entries of the same protein (UniProt Q9DCD6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6A9X 2.2 Å, Crystal Structure of AnkG/GABARAP Complex
5YIR 2.75 Å, Crystal Structure of AnkB LIR/GABARAP complex

Browse structure collections

About this viewer

MolViewer shows 7FB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.