IL-18Rbeta TIR domain. Determined by X-ray diffraction at 1.88 Å resolution. Released 20 Jul 2022.
Explore 7FCH in 3D Show helices and sheets RCSB PDB PDBe
7FCH contains 45 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 408-413 | 6 | 1 |
| α-helix | 430-432 | 3 | |
| α-helix | 433-437 | 5 | |
| α-helix | 438 | 1 | |
| α-helix | 439-445 | 7 | |
| β-strand | 450-451 | 2 | 1 |
| α-helix | 453-456 | 4 | |
| α-helix | 463-472 | 10 | |
| β-strand | 474-481 | 8 | 1 |
| α-helix | 483-486 | 4 | |
| α-helix | 491-501 | 11 | |
| β-strand | 508-513 | 6 | 1 |
| α-helix | 525-533 | 9 | |
| β-strand | 536-538 | 3 | 1 |
| α-helix | 550-558 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 408-413 | 6 | 2 |
| α-helix | 430-432 | 3 | |
| α-helix | 433-437 | 5 | |
| α-helix | 438 | 1 | |
| α-helix | 439-443 | 5 | |
| β-strand | 450-451 | 2 | 2 |
| α-helix | 453-456 | 4 | |
| α-helix | 458 | 1 | |
| α-helix | 463-472 | 10 | |
| β-strand | 474-481 | 8 | 2 |
| α-helix | 483-486 | 4 | |
| α-helix | 491-503 | 13 | |
| β-strand | 508-513 | 6 | 2 |
| α-helix | 525-533 | 9 | |
| β-strand | 536-538 | 3 | 2 |
| α-helix | 541-544 | 4 | |
| α-helix | 550-558 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 408-413 | 6 | 3 |
| α-helix | 430-431 | 2 | |
| α-helix | 432-437 | 6 | |
| α-helix | 438 | 1 | |
| α-helix | 439-445 | 7 | |
| β-strand | 450-451 | 2 | 3 |
| α-helix | 453-456 | 4 | |
| α-helix | 463-472 | 10 | |
| β-strand | 474-481 | 8 | 3 |
| α-helix | 483-487 | 5 | |
| α-helix | 491-503 | 13 | |
| β-strand | 508-513 | 6 | 3 |
| α-helix | 525-533 | 9 | |
| β-strand | 536-538 | 3 | 3 |
| α-helix | 541-543 | 3 | |
| α-helix | 550-558 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 408-413 | 6 | 4 |
| α-helix | 430-432 | 3 | |
| α-helix | 433-437 | 5 | |
| α-helix | 438 | 1 | |
| α-helix | 439-443 | 5 | |
| β-strand | 450-451 | 2 | 4 |
| α-helix | 453-456 | 4 | |
| α-helix | 458 | 1 | |
| α-helix | 463-472 | 10 | |
| β-strand | 474-481 | 8 | 4 |
| α-helix | 483-487 | 5 | |
| α-helix | 491-501 | 11 | |
| β-strand | 508-513 | 6 | 4 |
| α-helix | 525-533 | 9 | |
| β-strand | 536-538 | 3 | 4 |
| α-helix | 541-544 | 4 | |
| α-helix | 550-558 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-18 receptor accessory protein | A, B, C, D | protein | 166 | Homo sapiens | O95256 (AlphaFold model) |
>7FCH_1 Interleukin-18 receptor accessory protein (chains A, B, C, D) MKDFDAFVSYAKWSSFPSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYA EDIVSIIKRSRRGIFILSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLP HLVKKALRVLPTVTWRGLKSVPPNSRFWAKMRYHMPVKLEHHHHHH
Structural basis of the IL-1 receptor TIR domain-mediated IL-1 signaling. Zhou, J., Xiao, Y., Ren, Y. et al. iScience (2022) 25:104508. DOI 10.1016/j.isci.2022.104508
Other PDB entries of the same protein (UniProt O95256 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7FCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.