7FCZ: Human RIPK1 kinase domain

Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor. Determined by X-ray diffraction at 2.21 Å resolution. Released 19 Jan 2022.

Method: X-ray diffraction
Resolution: 2.21 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,085
Mol. weight: 68.25 kDa
Ligands: 3IF
Released: 19 Jan 2022

Explore 7FCZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7FCZ contains 32 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
α-helix	14-16	3
β-strand	17-23	7	1
β-strand	31-36	6	1
β-strand	40-49	10	1
α-helix	58-68	11
β-strand	72	1	2
β-strand	75	1	2
β-strand	78-84	7	1
β-strand	87-93	7	1
β-strand	99	1	2
α-helix	100-104	5
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	2
β-strand	152-154	3	2
α-helix	163-166	4
α-helix	204-205	2
α-helix	207-223	17
α-helix	236-242	7
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	276-277	2
α-helix	278-288	11
α-helix	289-293	5

Chain B: 17 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
β-strand	11	1	3
α-helix	14-16	3
β-strand	17-22	6	3
β-strand	30-36	7	3
β-strand	40-48	9	3
α-helix	57-68	12
β-strand	75	1	4
β-strand	80-84	5	3
β-strand	87-93	7	3
β-strand	99	1	4
α-helix	100-104	5
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	4
β-strand	152-154	3	4
α-helix	163-168	6
α-helix	195-197	3
α-helix	204-205	2
α-helix	207-223	17
α-helix	234-242	9
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	276-277	2
α-helix	278-288	11
α-helix	289-293	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-interacting serine/threonine-protein kinase 1	A, B	protein	297	Homo sapiens	Q13546 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7FCZ_1 Receptor-interacting serine/threonine-protein kinase 1 (chains A, B)
GASMQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLAFHRTQGLMIMKTVYKGPNCIEHN
EALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGR
IILEIIEGMAYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELR
EVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAIAEQQL
IMAIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLE

Ligands and cofactors

ID	Name	Formula	Copies
3IF	N-[(3S)-7-(2-cyclopropylethynyl)-5-methyl-4-oxidanylidene-2,3-dihydro-1,5-benzo…	C25 H23 N5 O3	2

Primary citation

Potent and Selective RIPK1 Inhibitors Targeting Dual-Pockets for the Treatment of Systemic Inflammatory Response Syndrome and Sepsis. Yang, X., Lu, H., Xie, H. et al. Angew Chem Int Ed Engl (2022) 61:e202114922-e202114922. DOI 10.1002/anie.202114922 · PubMed

Other PDB entries of the same protein (UniProt Q13546 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZMZ 1.4 Å, Amyloid core of RIP1
6AC5 1.45 Å, Crystal structure of RIPK1 death domain GlcNAcylated by EPEC effector NleB
4ITJ 1.8 Å, Crystal structure of RIP1 kinase in complex with necrostatin-4
6NW2 2.0 Å, Structure of human RIPK1 kinase domain in complex with compound 11
7FD0 2.0 Å, Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor
24IB 2.05 Å, Crystal structure of human RIPK1 kinase domain in complex with compound HR10
9Q31 2.05 Å, RIP1 kinase domain in complex with GDC-8264
6NYH 2.1 Å, Structure of human RIPK1 kinase domain in complex with GNE684
9GTY 2.15 Å, RIPK1 in complex with AZ"320
5HX6 2.23 Å, Crystal structure of RIP1 kinase with a benzo[b][1,4]oxazepin-4-one
4ITH 2.25 Å, Crystal structure of RIP1 kinase in complex with necrostatin-1 analog
9GTG 2.25 Å, RIPK1 in complex with AZ"902

Browse structure collections

About this viewer

MolViewer shows 7FCZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.