PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z741055844. Determined by X-ray diffraction at 1.15 Å resolution. Released 27 Nov 2024.
Explore 7HLU in 3D Show helices and sheets RCSB PDB PDBe
7HLU contains 6 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-13 | 3 | |
| β-strand | 14 | 1 | 1 |
| β-strand | 19 | 1 | 2 |
| α-helix | 21-23 | 3 | |
| β-strand | 28-30 | 3 | 1 |
| β-strand | 36-39 | 4 | 1 |
| β-strand | 58-60 | 3 | 3 |
| β-strand | 61 | 1 | 2 |
| β-strand | 65 | 1 | 3 |
| β-strand | 69-75 | 7 | 1 |
| β-strand | 82-88 | 7 | 3 |
| α-helix | 101-103 | 3 | |
| β-strand | 105-111 | 7 | 3 |
| β-strand | 114-117 | 4 | 3 |
| β-strand | 123-124 | 2 | 3 |
| β-strand | 133-139 | 7 | 1 |
| β-strand | 144-149 | 6 | 1 |
| α-helix | 150-152 | 3 | |
| β-strand | 155-160 | 6 | 1 |
| β-strand | 169-174 | 6 | 3 |
| α-helix | 185-186 | 2 | |
| β-strand | 187-189 | 3 | 1 |
| α-helix | 190-191 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase TRIM21 | B | protein | 188 | Mus musculus | Q62191 (AlphaFold model) |
>7HLU_1 E3 ubiquitin-protein ligase TRIM21 (chains B) MHHHHHHMVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFS SGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLH IQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAP LKLCPLKM
| ID | Name | Formula | Copies |
|---|---|---|---|
| S0V | morpholin-4-yl(1,2,3-thiadiazol-4-yl)methanone | C7 H9 N3 O2 S | 2 |
Water and common crystallization additives (SO4, EDO) are not listed.
PanDDA analysis group deposition. Kim, Y., Marples, P., Fearon, D. et al. To be published.
Other PDB entries of the same protein (UniProt Q62191 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7HLU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.