7JL4: TRIM65 PSpry domain

Crystal structure of TRIM65 PSpry domain. Determined by X-ray diffraction at 1.92 Å resolution. Released 9 Dec 2020.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,846
Mol. weight: 65.3 kDa
Released: 9 Dec 2020

Explore 7JL4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JL4 contains 10 α-helices and 54 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	314-316	3
α-helix	321-326	6
α-helix	327-329	3
β-strand	330	1	1
β-strand	335	1	2
β-strand	344-347	4	1
β-strand	352-355	4	1
β-strand	372-374	3	3
β-strand	375	1	2
β-strand	379	1	4
β-strand	383-390	8	1
β-strand	395-400	6	3
β-strand	422-427	6	3
β-strand	431-436	6	3
β-strand	439-444	6	3
β-strand	450-456	7	1
β-strand	461-466	6	1
β-strand	472-478	7	1
β-strand	485	1	4
β-strand	486-491	6	3
β-strand	496-499	4	1

Chain B: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	318-320	3
α-helix	321-326	6
α-helix	327-329	3
β-strand	330	1	9
β-strand	335	1	10
β-strand	344-347	4	9
β-strand	352-355	4	9
β-strand	372-374	3	11
β-strand	375	1	10
β-strand	379	1	12
β-strand	383-390	8	9
β-strand	395-400	6	11
β-strand	422-427	6	11
β-strand	431-436	6	11
β-strand	439-444	6	11
β-strand	450-456	7	9
β-strand	461-466	6	9
β-strand	472-478	7	9
β-strand	485	1	12
β-strand	486-491	6	11
β-strand	496-499	4	9
α-helix	500-501	2

Chain C: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	320-326	7
α-helix	327-329	3
β-strand	330	1	5
β-strand	335	1	6
α-helix	337-339	3
β-strand	344-347	4	5
β-strand	352-355	4	5
β-strand	372-374	3	7
β-strand	375	1	6
β-strand	379	1	8
β-strand	383-390	8	5
β-strand	395-400	6	7
β-strand	422-427	6	7
β-strand	431-436	6	7
β-strand	439-444	6	7
β-strand	450-456	7	5
β-strand	461-466	6	5
β-strand	472-478	7	5
β-strand	485	1	8
β-strand	486-491	6	7
β-strand	496-500	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tripartite motif-containing protein 65	A, B, C	protein	191	Homo sapiens	Q6PJ69 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7JL4_1 Tripartite motif-containing protein 65 (chains A, B, C)
LAPVPSTVCPLRRKLWQNYRNLTFDPVSANRHFYLSRQDQQVKHLRQSRGPGGPGSFELW
QVQCAQSFQAGHHYWEVRASDHSVTLGVSYPQLPRSRLGPHTDNIGRGPSSWGLCVQEDS
LQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWL
LEGRTLTLCHQ

Primary citation

Structural analysis of RIG-I-like receptors reveals ancient rules of engagement between diverse RNA helicases and TRIM ubiquitin ligases. Kato, K., Ahmad, S., Zhu, Z. et al. Mol Cell (2021) 81:599-613.e8. DOI 10.1016/j.molcel.2020.11.047 · PubMed

Other PDB entries of the same protein (UniProt Q6PJ69 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JL0 4.3 Å, Cryo-EM structure of MDA5-dsRNA in complex with TRIM65 PSpry domain (Monomer)
7JL2 4.3 Å, Cryo-EM structure of MDA5-dsRNA filament in complex with TRIM65 PSpry domain (Trimer)

Browse structure collections

About this viewer

MolViewer shows 7JL4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.