7JTG: RM11-43 Fab heavy chain

Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-43. Determined by X-ray diffraction at 2.6 Å resolution. Released 10 Mar 2021.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Macaca mulatta, Recombinant Hepatitis C virus HK6a/JFH-1
Chains: 3
Atoms: 4,517
Mol. weight: 68.91 kDa
Ligands: NAG
Released: 10 Mar 2021

Explore 7JTG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JTG contains 22 α-helices and 57 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
β-strand	33-39	7	2
β-strand	45-52	8	2
β-strand	56-59	4	2
α-helix	61-63	3
β-strand	67-70	4	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-95	8	2
α-helix	98-100A	4
β-strand	100K-103	4	2
β-strand	107-111	5	2
β-strand	117	1	3
α-helix	118-119	2
β-strand	120-124	5	4
α-helix	125-127	3
β-strand	135-145	11	4
β-strand	146	1	3
β-strand	151-154	4	5
α-helix	155-157	3
β-strand	159	1	5
β-strand	163-165	3	4
α-helix	166-168	3
β-strand	169-170	2	4
β-strand	176-185	10	4
β-strand	194-200	7	5
α-helix	201-203	3
β-strand	205-211	7	5

Chain B: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	33-38	6	7
α-helix	43-44	2
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	85-90	6	7
β-strand	97-98	2	7
β-strand	99	1	6
β-strand	102-106	5	7
β-strand	111	1	8
α-helix	112-113	2
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	144-150	7	10
β-strand	153-154	2	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-186	4
β-strand	191-198	8	10
β-strand	205-210	6	10

Chain E: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	422-424	3
β-strand	426-427	2	11
α-helix	439-442	4
β-strand	496-498	3	12
α-helix	499-501	3
β-strand	502-509	8	11
β-strand	513-516	4	11
β-strand	519	1	12
β-strand	525	1	12
β-strand	536-538	3	12
α-helix	539-541	3
β-strand	551-556	6	11
β-strand	561-564	4	11
β-strand	602	1	13
β-strand	607-609	3	13
α-helix	614-617	4
α-helix	619-621	3
β-strand	625-631	7	13
β-strand	638-644	7	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RM11-43 Fab heavy chain	A	protein	233	Macaca mulatta
RM11-43 Fab light chain	B	protein	214	Macaca mulatta
Envelope glycoprotein E2	E	protein	189	Recombinant Hepatitis C virus HK6a/JFH-1	B9V0E2

Sequence of entity 1 (A), FASTA

>7JTG_1 RM11-43 Fab heavy chain (chains A)
QVQLVQSGAEVKKPGASVKLSCKASGFTFRIYAISWVRQAPGQGLEWMGEIIPLGGITNY
AQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCARGETKMITVLAGTTGGGLDSWGQ
GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT
FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGS

Sequence of entity 2 (B), FASTA

>7JTG_2 RM11-43 Fab light chain (chains B)
DIQMTQSPSSLSASVGDKVTITCHASQGISSWLAWYQQKPGKAPKPLIYAASSLQSGVPS
RFSGGGSGADYTLTISSLQPEDFATYYCQQYDDLPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (E), FASTA

>7JTG_3 Envelope glycoprotein E2 (chains E)
QLINTNGSWHINRTALNCNDSLQTGFITSLFYAKNVDSSGCPERMAACGSSGCWHYAPRP
CDVVSARTVCGPVYCFTPSPVVVGTTDKLGIPTYNWGENETDVFMLESLRPPTGGWFGCT
WMNSTGFTKTCGAPPGGPTDGGSGPWITPRCLVDYPYRLWHYPCTVNFTLHKVRMFVGGI
EHRFDAACN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

HCV Env immunization elicits a rapid VH1-69-like broadly neutralizing antibody response in rhesus macaques. Tzarum, N., Chen, F., Lin, X. et al. Immunity (2021).

Other PDB entries of the same protein (UniProt B9V0E2), best resolution first:

6UYF 2.06 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
6WO4 2.35 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6WO3 2.38 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6BKC 2.6 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6BKB 2.8 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
9MNS 2.89 Å, Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to…
6BKD 3.25 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
7JTF 3.35 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6UYG 3.38 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2c3 core from genotype 6a bound to…

Browse structure collections

About this viewer

MolViewer shows 7JTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.