Kelch domain of human KEAP1 bound to Nrf2 peptide, ADEETGEAA. Determined by X-ray diffraction at 2.11 Å resolution. Released 7 Apr 2021.
Explore 7K2C in 3D Show helices and sheets RCSB PDB PDBe
7K2C contains 11 α-helices and 84 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 328-335 | 8 | 1 |
| β-strand | 337-338 | 2 | 1 |
| β-strand | 339 | 1 | 2 |
| β-strand | 342-345 | 4 | 1 |
| β-strand | 352-354 | 3 | 1 |
| α-helix | 356-358 | 3 | |
| β-strand | 362 | 1 | 2 |
| β-strand | 363 | 1 | 3 |
| β-strand | 366-370 | 5 | 4 |
| β-strand | 373-377 | 5 | 4 |
| β-strand | 380-383 | 4 | 3 |
| β-strand | 386-389 | 4 | 3 |
| β-strand | 393-397 | 5 | 4 |
| β-strand | 402-406 | 5 | 4 |
| α-helix | 407-409 | 3 | |
| β-strand | 414 | 1 | 5 |
| β-strand | 417-418 | 2 | 6 |
| β-strand | 421 | 1 | 7 |
| β-strand | 424 | 1 | 7 |
| β-strand | 425-428 | 4 | 6 |
| β-strand | 431-432 | 2 | 5 |
| β-strand | 435-436 | 2 | 5 |
| β-strand | 440-443 | 4 | 6 |
| β-strand | 451-452 | 2 | 6 |
| α-helix | 454-456 | 3 | |
| β-strand | 461 | 1 | 8 |
| β-strand | 464-468 | 5 | 9 |
| β-strand | 471-475 | 5 | 9 |
| β-strand | 478 | 1 | 8 |
| β-strand | 483 | 1 | 8 |
| β-strand | 487-491 | 5 | 9 |
| β-strand | 496-499 | 4 | 9 |
| α-helix | 501-503 | 3 | |
| β-strand | 508 | 1 | 10 |
| β-strand | 511-515 | 5 | 11 |
| β-strand | 518-522 | 5 | 11 |
| β-strand | 525 | 1 | 10 |
| β-strand | 530 | 1 | 10 |
| β-strand | 534-538 | 5 | 11 |
| β-strand | 543-546 | 4 | 11 |
| α-helix | 548-550 | 3 | |
| β-strand | 555 | 1 | 12 |
| β-strand | 558-561 | 4 | 13 |
| β-strand | 566-569 | 4 | 13 |
| β-strand | 572 | 1 | 12 |
| β-strand | 577 | 1 | 12 |
| β-strand | 580-585 | 6 | 13 |
| β-strand | 590-596 | 7 | 13 |
| β-strand | 602-608 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 326-331 | 6 | 14 |
| β-strand | 334-335 | 2 | 15 |
| β-strand | 337-338 | 2 | 15 |
| β-strand | 342-345 | 4 | 14 |
| β-strand | 352-354 | 3 | 14 |
| α-helix | 356-358 | 3 | |
| β-strand | 363 | 1 | 16 |
| β-strand | 366-370 | 5 | 17 |
| β-strand | 373-377 | 5 | 17 |
| β-strand | 380-383 | 4 | 16 |
| β-strand | 386-389 | 4 | 16 |
| β-strand | 393-397 | 5 | 17 |
| β-strand | 402-405 | 4 | 17 |
| α-helix | 407-409 | 3 | |
| β-strand | 414 | 1 | 18 |
| β-strand | 417-421 | 5 | 19 |
| β-strand | 424-428 | 5 | 19 |
| β-strand | 431-432 | 2 | 18 |
| β-strand | 435-436 | 2 | 18 |
| β-strand | 440-444 | 5 | 19 |
| β-strand | 449-453 | 5 | 19 |
| α-helix | 454-456 | 3 | |
| β-strand | 461 | 1 | 20 |
| β-strand | 464-468 | 5 | 20 |
| β-strand | 471-478 | 8 | 20 |
| β-strand | 483-491 | 9 | 20 |
| β-strand | 496-500 | 5 | 20 |
| α-helix | 501-503 | 3 | |
| β-strand | 508 | 1 | 21 |
| β-strand | 511-515 | 5 | 22 |
| β-strand | 518-522 | 5 | 22 |
| β-strand | 525 | 1 | 21 |
| β-strand | 530 | 1 | 21 |
| β-strand | 534-538 | 5 | 22 |
| β-strand | 543-547 | 5 | 22 |
| α-helix | 548-550 | 3 | |
| β-strand | 555 | 1 | 23 |
| β-strand | 558-562 | 5 | 24 |
| β-strand | 565-569 | 5 | 24 |
| β-strand | 572 | 1 | 23 |
| β-strand | 577 | 1 | 23 |
| β-strand | 580-585 | 6 | 24 |
| β-strand | 590-596 | 7 | 24 |
| β-strand | 602 | 1 | 15 |
| β-strand | 605-610 | 6 | 14 |
| α-helix | 611-612 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kelch-like ECH-associated protein 1 | A, B | protein | 290 | Homo sapiens | Q14145 (AlphaFold model) |
| Nrf2 peptide,ADEETGEAA | P | protein | 11 | synthetic construct | Q16236 (AlphaFold model) |
>7K2C_1 Kelch-like ECH-associated protein 1 (chains A, B) GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSP DGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYE PERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMN TIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVATATWTFVAPMKHRRSALGITVHQG RIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPSR
>7K2C_2 Nrf2 peptide,ADEETGEAA (chains P) XADEETGEAAX
Recapitulating the Binding Affinity of Nrf2 for KEAP1 in a Cyclic Heptapeptide, Guided by NMR, X-ray Crystallography, and Machine Learning. Ortet, P.C., Muellers, S.N., Viarengo-Baker, L.A. et al. J Am Chem Soc (2021) 143:3779-3793. DOI 10.1021/jacs.0c09799 · PubMed
Other PDB entries of the same protein (UniProt Q14145 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7K2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.