Crystal structure of the unliganded second bromodomain (BD2) of human TAF1. Determined by X-ray diffraction at 1.7 Å resolution. Released 22 Sept 2021.
Explore 7K3O in 3D Show helices and sheets RCSB PDB PDBe
7K3O contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1502-1513 | 12 | |
| α-helix | 1514-1519 | 6 | |
| α-helix | 1526-1528 | 3 | |
| α-helix | 1540-1543 | 4 | |
| α-helix | 1550-1558 | 9 | |
| α-helix | 1565-1583 | 19 | |
| α-helix | 1588-1606 | 19 | |
| α-helix | 1608-1620 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1502-1513 | 12 | |
| α-helix | 1514-1519 | 6 | |
| α-helix | 1526-1528 | 3 | |
| α-helix | 1540-1543 | 4 | |
| α-helix | 1550-1558 | 9 | |
| α-helix | 1565-1582 | 18 | |
| α-helix | 1588-1606 | 19 | |
| α-helix | 1608-1620 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription initiation factor TFIID subunit 1 | A, B | protein | 137 | Homo sapiens | P21675 (AlphaFold model) |
>7K3O_1 Transcription initiation factor TFIID subunit 1 (chains A, B) SMDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNIS KHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDI CTAKEAALEEAELESLD
Discovery of Dual TAF1-ATR Inhibitors and Ligand-Induced Structural Changes of the TAF1 Tandem Bromodomain. Karim, R.M., Yang, L., Chen, L. et al. J Med Chem (2022) 65:4182-4200. DOI 10.1021/acs.jmedchem.1c01999 · PubMed
Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7K3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.