7KQQ: Human WDR55

Crystal structure of human WDR55. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Dec 2020.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,009
Mol. weight: 69.99 kDa
Released: 30 Dec 2020

Explore 7KQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KQQ contains 7 α-helices and 62 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	28	1	1
α-helix	32-34	3
β-strand	35-36	2	2
β-strand	41-46	6	3
β-strand	52-57	6	3
β-strand	62-66	5	3
β-strand	70	1	1
β-strand	75-80	6	3
β-strand	87-92	6	4
β-strand	98-103	6	4
β-strand	108-112	5	4
β-strand	118-122	5	4
β-strand	130-135	6	5
β-strand	140-145	6	5
β-strand	150-154	5	5
β-strand	162-164	3	5
β-strand	171-176	6	6
β-strand	182-187	6	6
β-strand	192-196	5	6
β-strand	201-205	5	6
α-helix	206-209	4
β-strand	213-219	7	7
β-strand	224-229	6	7
β-strand	233-238	6	7
β-strand	241	1	7
β-strand	247-250	4	7
β-strand	258-261	4	8
β-strand	266-270	5	8
β-strand	275-280	6	8
β-strand	285-292	8	8
β-strand	298-303	6	2
β-strand	309-314	6	2
β-strand	318-323	6	2
α-helix	324-327	4

Chain B: 4 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	28	1	9
α-helix	32-34	3
β-strand	35-36	2	10
β-strand	41-46	6	11
β-strand	52-57	6	11
β-strand	62-66	5	11
β-strand	70	1	9
β-strand	75-80	6	11
β-strand	87-92	6	12
β-strand	98-103	6	12
β-strand	108-112	5	12
β-strand	118-122	5	12
β-strand	130-135	6	13
β-strand	140-145	6	13
β-strand	150-154	5	13
β-strand	162-164	3	13
β-strand	171-176	6	14
β-strand	182-187	6	14
β-strand	192-196	5	14
β-strand	201-205	5	14
α-helix	206-209	4
α-helix	212	1
β-strand	213-219	7	15
β-strand	224-229	6	15
β-strand	233-238	6	15
β-strand	241	1	15
β-strand	247-250	4	15
β-strand	258-261	4	16
β-strand	266-270	5	16
β-strand	275-280	6	16
β-strand	285-292	8	16
β-strand	298-303	6	10
β-strand	309-314	6	10
β-strand	318-323	6	10
α-helix	325-328	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat-containing protein 55	A, B	protein	315	Homo sapiens	Q9H6Y2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7KQQ_1 WD repeat-containing protein 55 (chains A, B)
GSMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWS
SGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDEN
VLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKR
RRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCM
VPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRL
KFWDMAQLRAVVVDD

Primary citation

Crystal structure of human WDR55. Zeng, H., Hutchinson, A., Li, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H6Y2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EKP 1.95 Å, Crystal structure of WDR55 in complex with XS381774
8FKY 2.67 Å, Human nucleolar pre-60S ribosomal subunit (State F)

Browse structure collections

About this viewer

MolViewer shows 7KQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.