7L3L: TRAF5 and TRAF6 RING Hetero dimer

Structure of TRAF5 and TRAF6 RING Hetero dimer. Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Feb 2021.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,894
Mol. weight: 58.76 kDa
Ligands: ZN
Released: 17 Feb 2021

Explore 7L3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7L3L contains 31 α-helices and 41 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	35	1	1
α-helix	41-43	3
β-strand	44	1	2
β-strand	51	1	2
β-strand	56-57	2	3
β-strand	63-64	2	3
α-helix	66-74	9
β-strand	80	1	4
β-strand	87	1	4
α-helix	90-92	3
β-strand	94-95	2	3
α-helix	97-104	8
β-strand	107-109	3	1
β-strand	119-121	3	1
α-helix	122-124	3
α-helix	125-129	5
β-strand	136	1	5
β-strand	149	1	5
α-helix	150-153	4
α-helix	156-160	5

Chain B: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	6
β-strand	60	1	7
α-helix	63-65	3
α-helix	66-68	3
β-strand	69	1	6
β-strand	76	1	6
β-strand	80-82	3	8
β-strand	88-90	3	8
α-helix	91-100	10
β-strand	104	1	9
β-strand	111	1	9
α-helix	114-116	3
β-strand	118-119	2	8
α-helix	121-129	9
β-strand	131-133	3	7
β-strand	142-144	3	7
α-helix	145-147	3
α-helix	148-152	5

Chain C: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	38-40	3
α-helix	41-43	3
β-strand	44	1	10
β-strand	51	1	10
α-helix	52	1
β-strand	56-57	2	11
β-strand	63-64	2	11
α-helix	66-75	10
β-strand	80	1	12
β-strand	87	1	12
α-helix	90-92	3
β-strand	94-95	2	11
α-helix	97-104	8
β-strand	107-109	3	13
β-strand	119-121	3	13
α-helix	122-124	3
α-helix	125-129	5
β-strand	136-137	2	14
β-strand	148-149	2	14
α-helix	154-158	5

Chain D: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	15
α-helix	63-65	3
α-helix	66-68	3
β-strand	69	1	15
β-strand	76	1	15
β-strand	80-82	3	16
β-strand	88-90	3	16
α-helix	91-100	10
β-strand	102	1	1
α-helix	114-116	3
β-strand	118-119	2	16
α-helix	121-128	8
α-helix	145-147	3
α-helix	148-151	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 5	A, C	protein	142	Homo sapiens	O00463 (AlphaFold model)
TNF receptor-associated factor 6	B, D	protein	107	Homo sapiens	Q9Y4K3 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7L3L_1 TNF receptor-associated factor 5 (chains A, C)
ISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICP
VDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNE
KCREPVLRKDLKEHLSASCQFR

Sequence of entity 2 (B, D), FASTA

>7L3L_2 TNF receptor-associated factor 6 (chains B, D)
EIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEI
LLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	14

Primary citation

The structure and ubiquitin binding properties of TRAF RING heterodimers. Das, A., Middleton, A.J., Padala, P. et al. J Mol Biol (2021):166844-166844. DOI 10.1016/j.jmb.2021.166844 · PubMed

Browse structure collections

About this viewer

MolViewer shows 7L3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.