7L7Q: Ctf3c with Ulp2-KIM

Ctf3c with Ulp2-KIM. Determined by electron microscopy at 3.7 Å resolution. Released 10 Feb 2021.

Method: Electron microscopy
Resolution: 3.7 Å
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 5,619
Mol. weight: 133.93 kDa
Released: 10 Feb 2021

Explore 7L7Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7L7Q contains 30 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	4-38	35
α-helix	47-71	25
α-helix	83-88	6
α-helix	91-95	5
α-helix	97-108	12
α-helix	110-133	24

Chain I: 22 helices, 0 β-strands

Element	Residues	Length
α-helix	296-301	6
α-helix	312-316	5
α-helix	337-347	11
α-helix	355-368	14
α-helix	375-387	13
α-helix	390-400	11
α-helix	410-420	11
α-helix	430-447	18
α-helix	457-474	18
α-helix	479-493	15
α-helix	507-524	18
α-helix	532-534	3
α-helix	539-546	8
α-helix	551-565	15
α-helix	578-588	11
α-helix	609-615	7
α-helix	641-653	13
α-helix	667-675	9
α-helix	678-683	6
α-helix	693-704	12
α-helix	710-712	3
α-helix	713-722	10

Chain K: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-39	34
α-helix	70-128	59

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inner kinetochore subunit MCM16	H	protein	184	Saccharomyces cerevisiae	Q12262 (AlphaFold model)
Inner kinetochore subunit CTF3	I	protein	736	Saccharomyces cerevisiae	Q12748 (AlphaFold model)
Inner kinetochore subunit MCM22	K	protein	242	Saccharomyces cerevisiae	P47167 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>7L7Q_1 Inner kinetochore subunit MCM16 (chains H)
SNAMTNSSEKQWERIQQLEKEHVEVYRELLITLDRLYLIRKHNHAVILSHTQQRLLEIRH
QLQINLEKTALLIRLLEKPDNTNVLFTKLQNLLEESNSLDYELLQSLGAQSSLHKQLIES
RAERDELMSKLIELSSKFPKPTIPPDDSDTAGKQVEVEKENETIQELMIALQIHSGYTNI
SYTI

Sequence of entity 2 (I), FASTA

>7L7Q_2 Inner kinetochore subunit CTF3 (chains I)
SNAMSLILDDIILSLTNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSI
IDTVTKVYIVENCFLPDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHV
YFLFPVHSEREHNISSSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMH
PGYRDAPGSATLILQRFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRI
LSRAHPANFPADTVQNTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLE
QLAQNWPQLHIPNDVDYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPY
EWCIWQLKRCFAHQIETPQEVIPIIISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVC
GGILPLWKPELISGTREFFVKFMASIFMWSTRDGHDNNCTFSETCFYVLQMITNWVLDDK
LIALGLTLLHDMQSLLTLDKIFNNATSNRFSTMAFISSLDILTQLSKQTKSDYAIQYLIV
GPDIMNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKV
LSSKSLFGVSPDFFKQILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENTK
IKFTSGIINEETFNNFFRVHHDEIGQHGWIKGVNNIHDLRVKILMHLSNTANPYRDIAAF
LFTYLKSLSKYSVQNS

Sequence of entity 3 (K), FASTA

>7L7Q_3 Inner kinetochore subunit MCM22 (chains K)
SNAMDVEKDVLDVYIKNLENQIGNKRYFLKQAQGAIDEITKRSLDTEGKPVNSEVFTELL
RKPMFFSERADPIGFSLTSNFLSLRAQSSSEWLSLMNDQSVDQKAMLLLQNNINSDLKEL
LRKLQHQMTIMDSKKQDHAHIRTRKARNKELWDSLADFLKGYLVPNLDDNDESIDSLTNE
VMLLMKRLIEHDLNLTLNDFSSKTIPIYRLLLRANIITVIEGSTNPGTKYIKLIDFNETS
LT

Primary citation

Ctf3/CENP-I provides a docking site for the desumoylase Ulp2 at the kinetochore. Quan, Y., Hinshaw, S.M., Wang, P.C. et al. J Cell Biol (2021) 220. DOI 10.1083/jcb.202012149 · PubMed

Other PDB entries of the same protein (UniProt Q12262 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YPC 2.9 Å, Crystal structure of the kinetochore subunits H/I/K/T/W penta-complex from S. cerevisiae…
6WUC 3.23 Å, The yeast Ctf3 complex with Cnn1-Wip1
10FI 3.3 Å, apo CCAN purified from budding yeast
8OVW 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to centromeric DNA
8OW0 3.4 Å, Cryo-EM structure of CBF1-CCAN bound topologically to a centromeric CENP-A nucleosome
6QLE 3.55 Å, Structure of inner kinetochore CCAN complex
8OW1 3.7 Å, Cryo-EM structure of the yeast Inner kinetochore bound to a CENP-A nucleosome.
10DQ 3.9 Å, Cbf1-CCAN-CEN complex
6QLD 4.15 Å, Structure of inner kinetochore CCAN-Cenp-A complex
6OUA 4.18 Å, Cryo-EM structure of the yeast Ctf3 complex
10JC 6.5 Å, CCAN dimer purified from budding yeast

Browse structure collections

About this viewer

MolViewer shows 7L7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.