S-adenosylmethionine synthetase co-crystallized with UppNHp. Determined by X-ray diffraction at 2.24 Å resolution. Released 31 Mar 2021.
Explore 7LL3 in 3D Show helices and sheets RCSB PDB PDBe
7LL3 contains 30 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-10 | 8 | 1 |
| α-helix | 15-31 | 17 | |
| β-strand | 38-46 | 9 | 2 |
| β-strand | 49-57 | 9 | 2 |
| α-helix | 64-75 | 12 | |
| β-strand | 78-79 | 2 | 3 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-85 | 2 | 3 |
| β-strand | 90-96 | 7 | 2 |
| α-helix | 111-113 | 3 | |
| α-helix | 114-115 | 2 | |
| β-strand | 116 | 1 | 4 |
| β-strand | 120-127 | 8 | 5 |
| α-helix | 136-153 | 18 | |
| β-strand | 160-173 | 14 | 1 |
| β-strand | 176-189 | 14 | 1 |
| α-helix | 195-202 | 8 | |
| α-helix | 203-207 | 5 | |
| α-helix | 213-215 | 3 | |
| β-strand | 221-224 | 4 | 1 |
| β-strand | 240-241 | 2 | 2 |
| β-strand | 265 | 1 | 2 |
| α-helix | 270-287 | 18 | |
| β-strand | 291 | 1 | 6 |
| β-strand | 293-300 | 8 | 5 |
| β-strand | 302 | 1 | 4 |
| β-strand | 309-313 | 5 | 5 |
| β-strand | 318 | 1 | 6 |
| α-helix | 322-332 | 11 | |
| α-helix | 337-344 | 8 | |
| α-helix | 352-355 | 4 | |
| α-helix | 366-368 | 3 | |
| α-helix | 373-378 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-10 | 5 | 7 |
| α-helix | 15-33 | 19 | |
| β-strand | 38-46 | 9 | 8 |
| β-strand | 49-57 | 9 | 8 |
| α-helix | 64-75 | 12 | |
| β-strand | 78-79 | 2 | 9 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-85 | 2 | 9 |
| β-strand | 90-96 | 7 | 8 |
| α-helix | 98-99 | 2 | |
| α-helix | 111-113 | 3 | |
| α-helix | 114-115 | 2 | |
| β-strand | 116 | 1 | 10 |
| β-strand | 120-127 | 8 | 11 |
| α-helix | 136-146 | 11 | |
| α-helix | 147-151 | 5 | |
| β-strand | 164-172 | 9 | 7 |
| β-strand | 177-187 | 11 | 7 |
| α-helix | 195-204 | 10 | |
| β-strand | 216-224 | 9 | 7 |
| β-strand | 240-241 | 2 | 8 |
| α-helix | 246-249 | 4 | |
| β-strand | 265 | 1 | 8 |
| α-helix | 270-287 | 18 | |
| β-strand | 291 | 1 | 12 |
| β-strand | 293-300 | 8 | 11 |
| β-strand | 302 | 1 | 10 |
| β-strand | 309-313 | 5 | 11 |
| β-strand | 318 | 1 | 12 |
| α-helix | 322-332 | 11 | |
| α-helix | 337-344 | 8 | |
| α-helix | 366-368 | 3 | |
| α-helix | 373-380 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| S-adenosylmethionine synthase | A, B | protein | 384 | Escherichia coli 908573 | P0A817 (AlphaFold model) |
>7LL3_1 S-adenosylmethionine synthase (chains A, B) MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTS AWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQ GLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVG IDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDC GLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVS YAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGH FGREHFPWEKTDKAQLLRDAAGLK
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
| PPK | (diphosphono)aminophosphonic acid | H6 N O9 P3 | 2 |
| UNP | 5'-O-[(R)-hydroxy{[(S)-hydroxy(phosphonoamino)phosphoryl]oxy}phosphoryl]uridine | C9 H16 N3 O14 P3 | 1 |
Water and common crystallization additives (EDO) are not listed.
Substrate Dynamics Contribute to Enzymatic Specificity in Human and Bacterial Methionine Adenosyltransferases. Gade, M., Tan, L.L., Damry, A.M. et al. JACS Au (2021) 1:2349-2360. DOI 10.1021/jacsau.1c00464 · PubMed
Other PDB entries of the same protein (UniProt P0A817 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7LL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.