7LP5: Nedd4L WW3 domain

Structure of Nedd4L WW3 domain. Determined by solution NMR. Released 28 Jul 2021.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 546
Mol. weight: 7.76 kDa
Released: 28 Jul 2021

Explore 7LP5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LP5 contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	110-113	4
α-helix	499-500	2
β-strand	503-507	5	1
β-strand	513-517	5	1
β-strand	522-524	3	1
α-helix	528-530	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiomotin,E3 ubiquitin-protein ligase NEDD4-like	A	protein	68	Homo sapiens	Q4VCS5 (AlphaFold model), Q96PU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7LP5_1 Angiomotin,E3 ubiquitin-protein ligase NEDD4-like (chains A)
MQNNEELPTYEEAKVGGGGGSKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLK
FPVHMRSK

Primary citation

Interactions between AMOT PPxY motifs and NEDD4L WW domains function in HIV-1 release. Rheinemann, L., Thompson, T., Mercenne, G. et al. J Biol Chem (2021) 297:100975-100975. DOI 10.1016/j.jbc.2021.100975 · PubMed

Other PDB entries of the same protein (UniProt Q4VCS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NP2 1.27 Å, Crystal structure of 14-3-3 sigma in complex with 20mer Amot-p130 peptide
7OQS 1.34 Å, Ternary complex of 14-3-3 sigma, Amot-p130 phosphopeptide, and WQ177
7NPB 1.37 Å, Crystal structure of 14-3-3 sigma in complex with 20mer Amot-p130 peptide and fragment 09
7NPG 1.37 Å, Crystal structure of 14-3-3 sigma in complex with 20mer Amot-p130 peptide and fragment 22
7NND 1.4 Å, Crystal structure of 14-3-3 sigma in complex with 13mer Amot-p130 peptide and fragment 09
7OQJ 1.4 Å, Ternary complex of 14-3-3 sigma, Amot-p130 phosphopeptide, and WQ162
7OQU 1.4 Å, Ternary complex of 14-3-3 sigma, Amot-p130 phosphopeptide, and WQ180
7NMW 1.5 Å, Crystal structure of 14-3-3 sigma in complex with 13mer Amot-p130 peptide and fragment 40
7OQG 1.5 Å, Ternary complex of 14-3-3 sigma, Amot-p130 phosphopeptide, and WQ136
7LP3 1.61 Å, Structure of Nedd4L WW3 domain
7NMA 1.75 Å, Crystal structure of 14-3-3 sigma in complex with 13mer Amot-p130 peptide
7NN2 1.8 Å, Crystal structure of 14-3-3 sigma in complex with 13mer Amot-p130 peptide and fragment 41

Browse structure collections

About this viewer

MolViewer shows 7LP5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.