Structure of Nedd4L WW3 domain. Determined by solution NMR. Released 28 Jul 2021.
Explore 7LP5 in 3D Show helices and sheets RCSB PDB PDBe
7LP5 contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 110-113 | 4 | |
| α-helix | 499-500 | 2 | |
| β-strand | 503-507 | 5 | 1 |
| β-strand | 513-517 | 5 | 1 |
| β-strand | 522-524 | 3 | 1 |
| α-helix | 528-530 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiomotin,E3 ubiquitin-protein ligase NEDD4-like | A | protein | 68 | Homo sapiens | Q4VCS5 (AlphaFold model), Q96PU5 (AlphaFold model) |
>7LP5_1 Angiomotin,E3 ubiquitin-protein ligase NEDD4-like (chains A) MQNNEELPTYEEAKVGGGGGSKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLK FPVHMRSK
Interactions between AMOT PPxY motifs and NEDD4L WW domains function in HIV-1 release. Rheinemann, L., Thompson, T., Mercenne, G. et al. J Biol Chem (2021) 297:100975-100975. DOI 10.1016/j.jbc.2021.100975 · PubMed
Other PDB entries of the same protein (UniProt Q4VCS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7LP5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.