7LZ6: Complex between GAD65 and b96.11 Fab

The Cryo-EM structure of a complex between GAD65 and b96.11 Fab. Determined by electron microscopy at 7.3 Å resolution. Released 30 Oct 2024.

Method: Electron microscopy
Resolution: 7.3 Å
Organism: Homo sapiens
Chains: 6
Atoms: 14,638
Mol. weight: 208.34 kDa
Released: 30 Oct 2024

Explore 7LZ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LZ6 contains 77 α-helices and 122 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	89-91	3
α-helix	94-96	3
α-helix	104-126	23
α-helix	138-143	6
α-helix	153-155	3
α-helix	156-169	14
β-strand	178	1	1
α-helix	188-200	13
β-strand	203	1	2
α-helix	207-209	3
α-helix	211-228	18
α-helix	231-233	3
β-strand	236-240	5	3
α-helix	243-258	16
α-helix	262-265	4
α-helix	267-269	3
β-strand	273-278	6	3
α-helix	284-291	8
α-helix	296-298	3
β-strand	299-302	4	3
α-helix	303	1
β-strand	304	1	4
β-strand	310	1	4
α-helix	312-324	13
β-strand	328-335	8	3
β-strand	336	1	5
β-strand	344	1	5
α-helix	347-356	10
β-strand	360-365	6	3
α-helix	369-373	5
α-helix	378-381	4
α-helix	384-386	3
β-strand	389-392	4	3
α-helix	394-397	4
β-strand	405-409	5	3
α-helix	414-419	6
α-helix	435-437	3
β-strand	449	1	2
α-helix	452-486	35
β-strand	491-493	3	6
β-strand	503-508	6	6
α-helix	511-513	3
α-helix	523-540	18
β-strand	544	1	1
β-strand	546-550	5	6
β-strand	553-560	8	6
α-helix	568-582	15

Chain B: 25 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	94-96	3
α-helix	104-125	22
α-helix	138-144	7
α-helix	148-150	3
α-helix	156-169	14
α-helix	171-172	2
β-strand	178-179	2	7
α-helix	188-200	13
α-helix	211-228	18
α-helix	231-233	3
β-strand	236-240	5	8
α-helix	243-258	16
α-helix	262-265	4
α-helix	267-269	3
β-strand	273-278	6	8
α-helix	283-291	9
α-helix	296-298	3
β-strand	299-302	4	8
β-strand	304	1	9
β-strand	310	1	9
α-helix	312-324	13
β-strand	328-335	8	8
β-strand	336	1	10
β-strand	344	1	10
α-helix	347-356	10
β-strand	360-364	5	8
α-helix	369-373	5
α-helix	378-381	4
α-helix	384-386	3
β-strand	389-392	4	8
α-helix	394-397	4
β-strand	405-409	5	8
α-helix	414-419	6
α-helix	452-487	36
β-strand	491-493	3	11
β-strand	504-508	5	11
α-helix	511-513	3
α-helix	523-540	18
β-strand	544-545	2	7
β-strand	546-550	5	11
β-strand	553-559	7	11
α-helix	568-581	14

Chain C: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	12
β-strand	10-12	3	13
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	34-39	6	13
β-strand	45-51	7	13
β-strand	60-62	3	13
α-helix	64-66	3
β-strand	70-75	6	12
α-helix	76-78	3
β-strand	80-85	6	12
α-helix	90-92	3
β-strand	94-101	8	13
β-strand	114-115	2	13
β-strand	121-125	5	13
β-strand	134-138	5	14
β-strand	149-157	9	14
β-strand	165-168	4	15
β-strand	173	1	15
β-strand	177-185	9	14
β-strand	189-199	11	14
α-helix	200-202	3
β-strand	203	1	16
β-strand	206	1	16
β-strand	208-213	6	15
β-strand	220-224	5	15

Chain D: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	17
β-strand	5	1	18
β-strand	9-12	4	19
β-strand	18-23	6	18
β-strand	35-40	6	19
β-strand	47-50	4	19
β-strand	51	1	20
β-strand	55	1	20
α-helix	56-57	2
β-strand	64-69	6	18
β-strand	72-77	6	18
α-helix	82-84	3
β-strand	87-93	7	19
β-strand	100-102	3	19
β-strand	103	1	17
β-strand	106-110	5	19
β-strand	119-123	5	21
α-helix	127-132	6
β-strand	135-142	8	21
β-strand	150-155	6	22
β-strand	158-160	3	22
β-strand	164-166	3	21
α-helix	167-169	3
β-strand	179-185	7	21
α-helix	187-190	4
β-strand	196-201	6	22
β-strand	206-211	6	22

Chain E: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	23
β-strand	10-12	3	24
β-strand	18-25	8	23
α-helix	29-31	3
β-strand	34-39	6	24
β-strand	45-51	7	24
β-strand	61-62	2	24
α-helix	64-66	3
β-strand	67	1	23
β-strand	70-75	6	23
α-helix	76-78	3
β-strand	80-85	6	23
α-helix	90-92	3
β-strand	94-101	8	24
β-strand	114-115	2	24
β-strand	121-125	5	24
α-helix	131-133	3
β-strand	134-138	5	25
β-strand	149-159	11	25
β-strand	165-168	4	26
α-helix	169-171	3
β-strand	177-185	9	25
β-strand	189-199	11	25
β-strand	209-213	5	26
β-strand	220-223	4	26

Chain F: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	27
β-strand	5	1	28
β-strand	9-12	4	29
β-strand	18-23	6	28
β-strand	35-40	6	29
β-strand	47-50	4	29
β-strand	51	1	30
β-strand	55	1	30
α-helix	56-57	2
β-strand	64-69	6	28
β-strand	72-77	6	28
α-helix	82-84	3
β-strand	86-93	8	29
α-helix	95-98	4
β-strand	100-102	3	29
β-strand	103	1	27
β-strand	106-110	5	29
β-strand	116	1	31
β-strand	119-123	5	32
α-helix	124-126	3
α-helix	127-132	6
β-strand	135-142	8	32
β-strand	145	1	31
β-strand	150-155	6	33
β-strand	158-159	2	33
β-strand	164-166	3	32
α-helix	167-169	3
α-helix	173-176	4
β-strand	179-185	7	32
α-helix	187-190	4
β-strand	196-201	6	33
β-strand	206-210	5	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate decarboxylase 2	A, B	protein	497	Homo sapiens	Q05329 (AlphaFold model)
b96.11 Fab heavy chain	C, E	protein	228	Homo sapiens
b96.11 Fab light chain	D, F	protein	217	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>7LZ6_1 Glutamate decarboxylase 2 (chains A, B)
NYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNELLQEYNW
ELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTY
EIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGM
AALPRLIAFTSEHSHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGF
VPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERA
NSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCG
RHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFW
YIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAAT
HQDIDFLIEEIERLGQD

Sequence of entity 2 (C, E), FASTA

>7LZ6_2 b96.11 Fab heavy chain (chains C, E)
EVQLVESGGGLVQPGRSLRLSCSASGFTFGDYAMSWFRLAPGKGLEWVGLIKSRAIDGTP
QYAASVKGRFTISRDDSNSIAYLQMNSLTTEDTAIYYCARDFYDFWNEFSHRTFDFWGQG
TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK

Sequence of entity 3 (D, F), FASTA

>7LZ6_3 b96.11 Fab light chain (chains D, F)
QSALTQPASASGSPGQSVTITCTGSSSDVGGYKYVSWYQHHPGKAPKLMIYEVSKRPSGV
PDRFSGSKSGNMASLTVSGLQAEDEADYYCSSYAGSYNFYVFGNGTKVTVLGQPKANPTV
TLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAAS
SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Structure and dynamics of GAD65 in complex with an autoimmune polyendocrine syndrome type 2-associated autoantibody. Stander, S.H.D., Reboul, C.F., Le, S.N. et al. Nat Commun (2025) 16:2275-2275. DOI 10.1038/s41467-025-57492-4 · PubMed

Other PDB entries of the same protein (UniProt Q05329 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OKK 2.3 Å, The X-ray crystal structure of the 65kDa isoform of Glutamic Acid Decarboxylase (GAD65)
1ES0 2.6 Å, Crystal structure of the murine class II allele I-A(G7) complexed with the glutamic acid…

Browse structure collections

About this viewer

MolViewer shows 7LZ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.