7LZR: BCL6 BTB domain

Crystal structure of the BCL6 BTB domain in complex with OICR-10256. Determined by X-ray diffraction at 1.34 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 1.34 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,550
Mol. weight: 60.73 kDa
Ligands: YJJ
Released: 16 Mar 2022

Explore 7LZR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LZR contains 28 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
α-helix	14-27	14
β-strand	34-38	5	2
β-strand	41-45	5	2
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	2
α-helix	74-75	2
α-helix	80-92	13
β-strand	94-95	2	3
α-helix	102-112	11
α-helix	115-127	13

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	3
α-helix	14-27	14
β-strand	34-38	5	4
β-strand	41-45	5	4
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	4
α-helix	80-92	13
β-strand	94-97	4	1
α-helix	102-112	11
α-helix	115-128	14

Chain C: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10	1	5
α-helix	14-27	14
β-strand	34-38	5	6
β-strand	41-45	5	6
α-helix	47-53	7
α-helix	55-62	8
α-helix	64-67	4
β-strand	71-73	3	6
α-helix	74-75	2
α-helix	80-92	13
β-strand	94-96	3	7
α-helix	102-112	11
α-helix	115-127	13

Chain D: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	7
α-helix	14-27	14
β-strand	34-38	5	8
β-strand	41-45	5	8
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	8
α-helix	74-75	2
α-helix	80-92	13
β-strand	94	1	5
α-helix	102-112	11
α-helix	115-126	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma 6 protein	A, B, C, D	protein	125	Homo sapiens	P41182 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7LZR_1 B-cell lymphoma 6 protein (chains A, B, C, D)
ADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQ
LKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKF
IKASE

Ligands and cofactors

ID	Name	Formula	Copies
YJJ	N-[5-chloro-2-(morpholin-4-yl)pyridin-4-yl]-2-[5-(3-cyano-4-hydroxy-5-methylphe…	C26 H24 Cl N7 O4	4

Water and common crystallization additives (CL, GOL, SO4) are not listed.

Primary citation

Crystal structure of the BCL6 BTB domain in complex with OICR-10256. Kuntz, D.A., Prive, G.G. To be published.

Other PDB entries of the same protein (UniProt P41182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWE 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7629
7RV1 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8826
7OKL 1.2 Å, Crystal structure of human BCL6 BTB domain in complex with compound 13e
7LWF 1.22 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9320
7RV4 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9153
7RV8 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-10268
7RUY 1.27 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8388
7RV2 1.29 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8828
1R29 1.3 Å, Crystal Structure of the B-Cell Lymphoma 6 (BCL6) BTB Domain to 1.3 Angstrom
7LWG 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-12694
7RUW 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7859
7RUX 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8311

Browse structure collections

About this viewer

MolViewer shows 7LZR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.