7M0G: Cofilin-2

Magic Angle Spinning NMR Structure of Human Cofilin-2 Assembled on Actin Filaments. Determined by solid-state NMR. Released 20 Apr 2022.

Method: Solid-state NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,317
Mol. weight: 18.77 kDa
Released: 20 Apr 2022

Explore 7M0G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M0G contains 8 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
α-helix	9-11	3
α-helix	12-19	8
α-helix	28-31	4
β-strand	37	1	2
β-strand	38-40	3	1
β-strand	46-49	4	1
α-helix	57-60	4
α-helix	68-74	7
β-strand	81-90	10	2
β-strand	95-104	10	2
α-helix	111-127	17
β-strand	131-137	7	2
α-helix	140-144	5
α-helix	146-153	8
β-strand	160-161	2	2
β-strand	164-165	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cofilin-2	A	protein	166	Homo sapiens	Q9Y281 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7M0G_1 Cofilin-2 (chains A)
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

Primary citation

Magic angle spinning NMR structure of human cofilin-2 assembled on actin filaments reveals isoform-specific conformation and binding mode. Kraus, J., Russell, R.W., Kudryashova, E. et al. Nat Commun (2022) 13:2114-2114. DOI 10.1038/s41467-022-29595-9 · PubMed

Other PDB entries of the same protein (UniProt Q9Y281 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y9P 2.06 Å, Cofilactin filament
9Y9L 3.06 Å, CP at the barbed end with one cofilin on second-to-last subunit
9Y9M 3.06 Å, Capping protein bound to the barbed end of cofilactin
9Q7K 3.13 Å, Pointed end of Cofilin-2 Bound F-actin
9Y52 3.46 Å, One CAP-1 Bound to the Pointed End of Cofilin F-actin
9Q7N 3.48 Å, Cofilin barbed end, cofilin on the two barbed end subunits
9Q7M 3.5 Å, Barbed end of cofilin actin, cofilin on second-to-last barbed end subunit
9Y9J 3.58 Å, Two CAP-1 Bound to the Pointed End of Cofilin F-actin
9Q7L 3.68 Å, Barbed end of F-actin and cofilin on sides
7U8K Magic Angle Spinning NMR Structure of Human Cofilin-2 Assembled on Actin Filaments

Browse structure collections

About this viewer

MolViewer shows 7M0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.