7M3P: Xrcc4-Spc110p(164-207) fusion

Xrcc4-Spc110p(164-207) fusion. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 May 2021.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae
Chains: 2
Atoms: 2,965
Mol. weight: 41.47 kDa
Released: 12 May 2021

Explore 7M3P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M3P contains 10 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
β-strand	13-24	12	1
α-helix	28-30	3
β-strand	31-37	7	1
β-strand	42-48	7	1
α-helix	49-58	10
α-helix	63-70	8
α-helix	71-75	5
β-strand	84-89	6	1
β-strand	94-101	8	1
β-strand	104-112	9	1
β-strand	114-115	2	1
α-helix	119-172	54

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	2
β-strand	10	1	3
β-strand	18-23	6	2
α-helix	28-30	3
β-strand	32-37	6	2
β-strand	42-47	6	2
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-88	5	3
β-strand	94-101	8	3
β-strand	104-112	9	3
β-strand	114-115	2	2
α-helix	116	1
α-helix	119-173	55

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Xrcc4-Spc110p(164-207)	A, B	protein	183	Homo sapiens, Saccharomyces cerevisiae	P32380 (AlphaFold model), Q13426 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7M3P_1 Xrcc4-Spc110p(164-207) (chains A, B)
GPGSGGSGERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEIS
QEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNL
EKVENPAEVIRELICYCLDEIKSLKHEIKELRKEKNDTLNNYDTLEEETDDLKNRLQALE
KEL

Primary citation

CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation. Brilot, A.F., Lyon, A.S., Zelter, A. et al. Elife (2021) 10. DOI 10.7554/eLife.65168 · PubMed

Other PDB entries of the same protein (UniProt P32380 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DS7 2.15 Å, Crystal structure of yeast calmodulin bound to the C-terminal fragment of spindle pole…
7M2W 3.0 Å, Engineered disulfide cross-linked closed conformation of the Yeast gamma-TuRC(SS)
7M2X 3.6 Å, Open conformation of the Yeast wild-type gamma-TuRC
7M2Y 4.03 Å, Closed conformation of the Yeast wild-type gamma-TuRC
8QV3 8.2 Å, Structure of the y-Tubulin Small Complex (yTuSC) as part of the native y-Tubulin Ring…
8QV2 9.2 Å, Structure of the native y-Tubulin Ring Complex (yTuRC) capping microtubule minus ends at…
9A15 Integrative structure of the yeast gammaTuSC-Spc110 monomer complex
9A16 Integrative structure of the yeast gammaTuSC-Spc110 dimer complex
9A17 Integrative structure of the yeast gammaTuSC-Spc110 tetramer complex

Browse structure collections

About this viewer

MolViewer shows 7M3P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.