7MKJ: Escherichia coli RNA polymerase

Cryo-EM structure of Escherichia coli RNA polymerase bound to T7A1 promoter DNA. Determined by electron microscopy at 2.9 Å resolution. Released 29 Sept 2021.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Escherichia coli, Escherichia phage T7
Chains: 9
Atoms: 32,007
Mol. weight: 554.64 kDa
Ligands: 1N7, MG, ZN
Released: 29 Sept 2021

Explore 7MKJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MKJ contains 178 α-helices and 235 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	13-20	8	1
β-strand	23-31	9	1
α-helix	35-49	15
β-strand	52-61	10	2
β-strand	74	1	2
α-helix	78-85	8
β-strand	90	1	3
β-strand	97-111	15	2
α-helix	112-114	3
β-strand	115	1	2
α-helix	116-117	2
β-strand	123	1	3
β-strand	129-150	22	2
β-strand	152-153	2	4
α-helix	155-158	4
α-helix	170	1
β-strand	171-172	2	2
β-strand	175-176	2	4
β-strand	182-187	6	1
β-strand	199-206	8	1
α-helix	213-228	16

Chain H: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	15-16	2	5
β-strand	19	1	6
β-strand	23	1	6
β-strand	26-31	6	5
α-helix	32	1
α-helix	35-49	15
β-strand	53-59	7	7
β-strand	61	1	8
β-strand	74	1	9
α-helix	78-86	9
β-strand	90-92	3	10
β-strand	99-101	3	7
β-strand	104-105	2	11
β-strand	109-111	3	12
α-helix	112-114	3
α-helix	116-117	2
β-strand	121-123	3	10
β-strand	129-132	4	12
β-strand	133	1	9
α-helix	134	1
β-strand	139-140	2	11
β-strand	142	1	8
β-strand	143-149	7	7
β-strand	152-153	2	13
β-strand	171-172	2	7
β-strand	175-176	2	13
β-strand	180-184	5	6
β-strand	187-188	2	5
β-strand	199-203	5	5
β-strand	204-207	4	6
α-helix	213-227	15

Chain I: 57 helices, 100 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	14
α-helix	19-20	2
α-helix	29-38	10
α-helix	49-56	8
α-helix	57-58	2
β-strand	59-60	2	15
β-strand	66-75	10	15
α-helix	82-88	7
β-strand	93-104	12	15
β-strand	116-128	13	15
β-strand	130	1	16
β-strand	136-137	2	16
β-strand	142-145	4	16
β-strand	147-151	5	17
α-helix	152	1
β-strand	154-158	5	18
β-strand	173-177	5	18
β-strand	180	1	19
β-strand	184-188	5	18
β-strand	194-198	5	18
β-strand	204-205	2	18
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-231	5	20
β-strand	239-240	2	20
α-helix	243-246	4
β-strand	250-251	2	21
β-strand	255-257	3	22
β-strand	260-263	4	22
β-strand	267-268	2	21
α-helix	271-280	10
β-strand	284-285	2	20
α-helix	289-292	4
α-helix	295	1
β-strand	296	1	23
β-strand	297	1	20
β-strand	301-302	2	24
β-strand	309-311	3	24
β-strand	316	1	23
α-helix	319-326	8
β-strand	332-336	5	20
α-helix	346-353	8
α-helix	359-370	12
α-helix	375-377	3
α-helix	378-389	12
β-strand	396	1	19
α-helix	399-408	10
α-helix	422-437	16
β-strand	451-454	4	17
α-helix	456-479	24
α-helix	495-507	13
β-strand	512-514	3	16
α-helix	520-527	8
β-strand	529	1	25
β-strand	530-531	2	17
α-helix	550-551	2
α-helix	552-554	3
β-strand	558	1	26
β-strand	574	1	25
β-strand	575	1	26
β-strand	576	1	27
β-strand	580-581	2	28
β-strand	587-594	8	28
β-strand	599-607	9	28
α-helix	610-613	4
β-strand	616-617	2	28
β-strand	623	1	29
β-strand	629	1	29
β-strand	633-639	7	28
β-strand	641-646	6	28
β-strand	652-654	3	28
β-strand	662	1	27
α-helix	671-673	3
β-strand	674	1	30
α-helix	676-685	10
β-strand	689	1	31
α-helix	690-691	2
β-strand	700-701	2	14
α-helix	705-711	7
β-strand	716-717	2	32
β-strand	722-728	7	33
β-strand	731-736	6	33
α-helix	738-740	3
β-strand	748-752	5	33
α-helix	753-754	2
β-strand	757-758	2	34
β-strand	763	1	35
β-strand	764-765	2	34
β-strand	768-769	2	32
β-strand	776-777	2	33
β-strand	782-785	4	32
β-strand	789-790	2	36
β-strand	793-794	2	36
β-strand	798-804	7	37
β-strand	816-818	3	37
α-helix	821-824	4
β-strand	830-841	12	35
β-strand	842-843	2	38
β-strand	846-847	2	38
β-strand	849	1	39
α-helix	861-863	3
β-strand	865	1	40
β-strand	870	1	41
β-strand	871	1	40
α-helix	872	1
β-strand	876-877	2	35
β-strand	882-884	3	41
β-strand	887-889	3	39
α-helix	897-906	10
β-strand	913-915	3	39
β-strand	918-919	2	41
α-helix	920-921	2
β-strand	926-935	10	35
β-strand	936	1	42
α-helix	940-942	3
α-helix	943-980	38
α-helix	994-998	5
α-helix	1006-1037	32
β-strand	1040	1	42
α-helix	1042-1043	2
β-strand	1046-1058	13	35
β-strand	1065-1067	3	43
β-strand	1074-1075	2	43
β-strand	1076-1079	4	37
α-helix	1082-1084	3
β-strand	1087	1	44
α-helix	1092	1
β-strand	1093	1	44
α-helix	1094	1
β-strand	1096-1098	3	37
α-helix	1100-1102	3
β-strand	1108	1	30
α-helix	1110-1133	24
α-helix	1138-1149	12
α-helix	1161-1163	3
α-helix	1168-1175	8
β-strand	1182-1183	2	14
α-helix	1192-1201	10
β-strand	1209-1210	2	37
β-strand	1213	1	44
α-helix	1219	1
β-strand	1220	1	44
α-helix	1221	1
β-strand	1225-1232	8	37
β-strand	1233-1234	2	43
β-strand	1235	1	31
β-strand	1246	1	45
β-strand	1251	1	46
β-strand	1252	1	47
β-strand	1258	1	46
β-strand	1268-1270	3	48
α-helix	1272-1280	9
α-helix	1284-1288	5
α-helix	1289-1293	5
α-helix	1298-1309	12
α-helix	1321-1331	11
β-strand	1335-1340	6	49

Chain J: 69 helices, 89 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	49
α-helix	27-33	7
β-strand	34-37	4	50
β-strand	44	1	51
β-strand	51	1	51
α-helix	52	1
α-helix	59-62	4
α-helix	78-80	3
β-strand	84	1	52
β-strand	91	1	52
α-helix	95-99	5
β-strand	102-112	11	50
α-helix	115-118	4
α-helix	123-127	5
α-helix	132-139	8
β-strand	144-146	3	53
β-strand	159-160	2	53
α-helix	162-171	10
β-strand	178-179	2	53
α-helix	182-190	9
α-helix	194-207	14
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-244	7	50
α-helix	247-249	3
β-strand	254	1	54
β-strand	260	1	54
β-strand	261-262	2	55
α-helix	264-284	21
α-helix	289-307	19
β-strand	317	1	56
β-strand	323	1	56
α-helix	324-325	2
α-helix	328-330	3
α-helix	337	1
α-helix	338-342	5
β-strand	345-347	3	48
β-strand	350-354	5	45
β-strand	355-356	2	57
β-strand	365-369	5	57
α-helix	370-376	7
α-helix	378-385	8
α-helix	394-400	7
α-helix	408-415	8
β-strand	421-425	5	45
α-helix	431-433	3
β-strand	434-437	4	45
β-strand	438-442	5	57
β-strand	447-448	2	57
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	45
α-helix	476-482	7
β-strand	485	1	45
β-strand	491	1	58
β-strand	498	1	58
α-helix	507-513	7
α-helix	525	1
β-strand	526	1	59
α-helix	527	1
α-helix	530-538	9
β-strand	547-556	10	59
β-strand	564-573	10	59
α-helix	574-580	7
α-helix	589-591	3
α-helix	599-609	11
α-helix	614-633	20
α-helix	650-657	8
α-helix	664-669	6
α-helix	675-701	27
β-strand	706-709	4	60
β-strand	712-715	4	60
α-helix	721-727	7
β-strand	745	1	61
β-strand	748	1	62
β-strand	754	1	62
β-strand	759	1	61
α-helix	769-774	6
α-helix	777-785	9
α-helix	789-804	16
β-strand	809	1	63
β-strand	820-822	3	64
β-strand	825-826	2	65
β-strand	831-833	3	65
α-helix	835-839	5
β-strand	843	1	66
β-strand	844	1	64
β-strand	848-849	2	67
β-strand	856-858	3	67
β-strand	863	1	66
α-helix	868-874	7
β-strand	880-882	3	64
α-helix	885-887	3
β-strand	894	1	63
β-strand	901	1	68
β-strand	908	1	68
α-helix	909-910	2
α-helix	915-924	10
α-helix	926-928	3
β-strand	949-950	2	69
β-strand	956-961	6	70
β-strand	965-967	3	69
β-strand	973-975	3	69
β-strand	980-985	6	70
β-strand	991-997	7	70
β-strand	1002-1003	2	69
β-strand	1010-1011	2	70
α-helix	1012	1
β-strand	1018-1019	2	69
β-strand	1025	1	71
β-strand	1033	1	72
β-strand	1034	1	73
β-strand	1038	1	74
β-strand	1042	1	75
β-strand	1046	1	75
β-strand	1049-1050	2	76
β-strand	1057-1058	2	76
β-strand	1059-1060	2	77
β-strand	1061	1	75
α-helix	1062	1
α-helix	1069-1072	4
β-strand	1077	1	74
β-strand	1081	1	73
β-strand	1087	1	73
β-strand	1089	1	78
β-strand	1096	1	78
β-strand	1100	1	74
β-strand	1106-1107	2	77
α-helix	1110	1
β-strand	1115	1	72
β-strand	1124	1	71
α-helix	1138-1145	8
α-helix	1148-1150	3
α-helix	1153-1155	3
β-strand	1156	1	79
α-helix	1157	1
β-strand	1162-1165	4	80
β-strand	1172	1	81
β-strand	1175-1178	4	80
β-strand	1187-1188	2	80
β-strand	1191	1	81
α-helix	1204-1205	2
β-strand	1209	1	79
α-helix	1214-1216	3
α-helix	1217-1224	8
α-helix	1226-1236	11
α-helix	1238-1242	5
α-helix	1251-1258	8
β-strand	1263-1268	6	82
β-strand	1279-1281	3	82
α-helix	1282-1294	13
α-helix	1299-1300	2
β-strand	1301-1305	5	82
α-helix	1320-1323	4
α-helix	1328-1337	10
β-strand	1341-1342	2	49
α-helix	1347-1353	7
α-helix	1363-1372	10

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	18-31	14
α-helix	46-56	11
α-helix	61-77	17

Chain L: 29 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	97-105	9
α-helix	109-111	3
α-helix	113-134	22
α-helix	138-152	15
β-strand	162-165	4	83
α-helix	214-234	21
α-helix	243-256	14
β-strand	259-261	3	83
α-helix	263-291	29
α-helix	299-301	3
α-helix	302-306	5
α-helix	330-347	18
α-helix	355-382	28
α-helix	384-391	8
α-helix	401-418	18
α-helix	421-423	3
α-helix	427-446	20
α-helix	454-469	16
α-helix	471-474	4
α-helix	480-487	8
α-helix	491-498	8
α-helix	504	1
β-strand	505-506	2	55
β-strand	510	1	84
β-strand	518	1	84
α-helix	519-522	4
α-helix	523	1
β-strand	524	1	47
α-helix	525	1
α-helix	529-530	2
α-helix	531-549	19
α-helix	555-562	8
α-helix	573-580	8
α-helix	584-599	16
α-helix	607-610	4

Chain R: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	256	1	85
α-helix	257-260	4
α-helix	264-272	9
β-strand	277	1	85
α-helix	278-283	6
α-helix	286-291	6
α-helix	297-309	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	G, H, R	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1407	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	613	Escherichia coli	P00579
Nontemplate strand of T7A1 promoter DNA	P	DNA	91	Escherichia phage T7
Template strand of T7A1 promoter DNA	Q	DNA	91	Escherichia phage T7

Sequence of entity 1 (G, H, R), FASTA

>7MKJ_1 DNA-directed RNA polymerase subunit alpha (chains G, H, R)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (I), FASTA

>7MKJ_2 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (J), FASTA

>7MKJ_3 DNA-directed RNA polymerase subunit beta' (chains J)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (K), FASTA

>7MKJ_4 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (L), FASTA

>7MKJ_5 RNA polymerase sigma factor RpoD (chains L)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 6 (P), FASTA

>7MKJ_6 Nontemplate strand of T7A1 promoter DNA (chains P)
CGATTAATTTAAAATTTATCAAAAAGAGTATTGACTTAAAGTCTAACCTATAGGATACTT
ACAGCCATCGAGAGGGACACGGCGAATAGCC

Sequence of entity 7 (Q), FASTA

>7MKJ_7 Template strand of T7A1 promoter DNA (chains Q)
GGCTATTCGCCGTGTCCCTCTCGATGGCTGTAAGTATCCTATAGGTTAGACTTTAAGTCA
ATACTCTTTTTGATAAATTTTAAATTAATCG

Ligands and cofactors

ID	Name	Formula	Copies
1N7	Chapso	C32 H59 N2 O8 S	3
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	2

Primary citation

Structural origins of Escherichia coli RNA polymerase open promoter complex stability. Saecker, R.M., Chen, J., Chiu, C.E. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2112877118 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 7MKJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.