7MNI: N-terminal domain of NUP88

Crystal structure of the N-terminal domain of NUP88 in complex with NUP98 C-terminal Autoproteolytic Domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Jun 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 9,442
Mol. weight: 143.79 kDa
Released: 15 Jun 2022

Explore 7MNI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MNI contains 38 α-helices and 98 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
α-helix	18-20	3
α-helix	22-32	11
α-helix	56-58	3
β-strand	59	1	1
β-strand	61-64	4	2
β-strand	67-72	6	2
β-strand	77-82	6	2
β-strand	99-103	5	2
α-helix	110-111	2
β-strand	113-116	4	1
β-strand	122-126	5	1
β-strand	131-135	5	1
α-helix	136-138	3
β-strand	139-140	2	3
β-strand	145-146	2	3
α-helix	147-149	3
β-strand	152-155	4	2
β-strand	157-160	4	1
α-helix	162-167	6
β-strand	173-178	6	4
α-helix	185-186	2
β-strand	187-192	6	4
β-strand	196-201	6	4
β-strand	210-213	4	4
β-strand	230-231	2	5
β-strand	238-243	6	6
β-strand	247-250	4	7
α-helix	251-254	4
β-strand	261-264	4	7
β-strand	265-271	7	6
β-strand	276-281	6	6
β-strand	289-290	2	4
β-strand	294	1	6
α-helix	297-298	2
β-strand	299-300	2	8
β-strand	311-317	7	8
β-strand	323-328	6	8
β-strand	332-339	8	8
β-strand	340	1	9
β-strand	362-370	9	8
β-strand	394-397	4	10
β-strand	404-409	6	10
β-strand	412-417	6	10
α-helix	421-423	3
β-strand	429	1	9
α-helix	432-442	11
β-strand	448-454	7	10
β-strand	468-472	5	11
β-strand	479-483	5	11
β-strand	489-492	4	11

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	718	1	12
β-strand	724-727	4	13
α-helix	730-736	7
β-strand	744-752	9	13
β-strand	756-765	10	13
β-strand	770	1	12
α-helix	771-774	4
β-strand	775-778	4	5
β-strand	781-784	4	5
α-helix	791-793	3
β-strand	802-806	5	13
β-strand	812	1	14
β-strand	819	1	14
α-helix	823-828	6
α-helix	831-840	10
β-strand	844-850	7	13
α-helix	851-853	3
β-strand	855-860	6	13

Chain C: 13 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	14-17	4
α-helix	18-20	3
α-helix	22-31	10
α-helix	55-58	4
β-strand	59	1	15
β-strand	61-64	4	16
β-strand	67-72	6	16
β-strand	77-82	6	16
β-strand	99-103	5	16
α-helix	110-111	2
β-strand	113-116	4	15
β-strand	122-126	5	15
β-strand	131-135	5	15
α-helix	136-138	3
β-strand	139-140	2	17
β-strand	145-146	2	17
α-helix	147-149	3
β-strand	152-155	4	16
β-strand	157-160	4	15
α-helix	162-166	5
β-strand	173-178	6	18
α-helix	185-186	2
β-strand	187-192	6	18
β-strand	196-201	6	18
β-strand	210-213	4	18
β-strand	230-231	2	19
β-strand	238-243	6	20
β-strand	247-250	4	21
α-helix	251-254	4
β-strand	261-264	4	21
β-strand	265-271	7	20
β-strand	276-281	6	20
β-strand	289-290	2	18
β-strand	294	1	20
α-helix	296-298	3
β-strand	299-300	2	22
β-strand	311-317	7	22
β-strand	323-328	6	22
β-strand	332-339	8	22
β-strand	362-370	9	22
β-strand	394-398	5	23
β-strand	401-409	9	23
β-strand	412-417	6	23
α-helix	419-423	5
α-helix	432-444	13
β-strand	448-454	7	23
β-strand	468-472	5	24
β-strand	479-483	5	24
β-strand	489-492	4	24

Chain D: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	718	1	25
β-strand	724-727	4	26
α-helix	730-740	11
β-strand	744-752	9	26
β-strand	756-765	10	26
β-strand	770	1	25
α-helix	771-774	4
β-strand	775-778	4	19
β-strand	781-784	4	19
α-helix	788-790	3
α-helix	791-793	3
β-strand	802-806	5	26
β-strand	812	1	27
β-strand	819	1	27
α-helix	823-828	6
α-helix	831-841	11
β-strand	845-850	6	26
β-strand	855-860	6	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup88	A, C	protein	494	Homo sapiens	Q99567 (AlphaFold model)
Nuclear pore complex protein Nup98	B, D	protein	153	Homo sapiens	P52948 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7MNI_1 Nuclear pore complex protein Nup88 (chains A, C)
SMAAAEGPVGDGELWQTWLPNHVVFLRLREGLKNQSPTEAEKPASSSLPSSPPPQLLTRN
VVFGLGGELFLWDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPT
QHHVALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWY
PSEILDPHVVLLTSDNVIRIYSLREPQTPTNVIILSEAEEESLVLNKGRAYTASLGETAV
AFDFGPLAAVPKTLFGQNGKDEVVAYPLYILYENGETFLTYISLLHSPGNIGKLLGPLPM
HPAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDL
IPSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHRDPKCPSRYHCTHEAGVHSVGLT
WIHKLHKFLGSDEEDKDSLQELSTEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPT
MICITSTYECLIWP

Sequence of entity 2 (B, D), FASTA

>7MNI_2 Nuclear pore complex protein Nup98 (chains B, D)
GPHMAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLN
LDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADIN
YEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF

Primary citation

Architecture of the cytoplasmic face of the nuclear pore. Bley, C.J., Nie, S., Mobbs, G.W. et al. Science (2022) 376:eabm9129-eabm9129. DOI 10.1126/science.abm9129 · PubMed

Other PDB entries of the same protein (UniProt Q99567 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7R5K 12.0 Å, Human nuclear pore complex (constricted)
7R5J 50.0 Å, Human nuclear pore complex (dilated)

Browse structure collections

About this viewer

MolViewer shows 7MNI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.