7MU2: WIPI2

Crystal Structure of WIPI2 in complex with W2IR of ATG16L1. Determined by X-ray diffraction at 1.85 Å resolution. Released 26 May 2021.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,665
Mol. weight: 77.21 kDa
Released: 26 May 2021

Explore 7MU2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MU2 contains 10 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	1
β-strand	26-31	6	1
β-strand	35-39	5	1
β-strand	48-52	5	1
β-strand	58-63	6	2
β-strand	69-74	6	2
β-strand	77-85	9	2
β-strand	90-96	7	2
β-strand	103-106	4	3
β-strand	110-114	5	3
β-strand	119-123	5	3
β-strand	129-133	5	3
α-helix	136	1
α-helix	138	1
β-strand	145-146	2	4
β-strand	154-158	5	4
β-strand	164-170	7	4
β-strand	175-183	9	4
α-helix	186	1
β-strand	187-192	6	5
β-strand	198-203	6	5
β-strand	208-213	6	5
β-strand	219-224	6	5
β-strand	233-238	6	6
β-strand	244-249	6	6
β-strand	253-258	6	6
β-strand	300	1	5
β-strand	303-306	4	6
β-strand	314-321	8	7
β-strand	324-331	8	7
β-strand	335-340	6	7
β-strand	347-348	2	6
α-helix	349	1
β-strand	350-356	7	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	212-228	17

Chain C: 4 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	8
β-strand	26-31	6	8
β-strand	34-39	6	8
β-strand	47-52	6	8
β-strand	58-63	6	9
β-strand	69-74	6	9
β-strand	77-85	9	9
β-strand	90-96	7	9
β-strand	103-106	4	10
β-strand	110-114	5	10
β-strand	119-123	5	10
β-strand	129-133	5	10
α-helix	136	1
α-helix	138	1
β-strand	145-146	2	11
β-strand	154-158	5	11
β-strand	164-170	7	11
β-strand	175-183	9	11
α-helix	186	1
β-strand	187-192	6	12
β-strand	198-203	6	12
β-strand	208-213	6	12
β-strand	219-224	6	12
β-strand	233-238	6	13
β-strand	244-249	6	13
β-strand	253-258	6	13
β-strand	298-299	2	12
β-strand	303-306	4	13
β-strand	314-321	8	14
β-strand	324-331	8	14
β-strand	335-340	6	14
β-strand	347-348	2	13
α-helix	349-350	2
β-strand	351-356	6	14

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	221-227	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat domain phosphoinositide-interacting protein 2	A, C	protein	324	Homo sapiens	Q9Y4P8 (AlphaFold model)
Autophagy-related protein 16-1	B, D	protein	25	Homo sapiens	E7EVC7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7MU2_1 WD repeat domain phosphoinositide-interacting protein 2 (chains A, C)
MAGQLLFANFNQDNTSLAVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSSLV
AIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMKVL
HTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAAL
AFDASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSN
TETVHIFKLETVGSGSFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAADGYLYMY
NLDPQEGGECALMKQHRLDGSLET

Sequence of entity 2 (B, D), FASTA

>7MU2_2 Autophagy-related protein 16-1 (chains B, D)
YAENEKDSRRRQARLQKELAEAAKE

Primary citation

Structural basis for membrane recruitment of ATG16L1 by WIPI2 in autophagy. Strong, L.M., Chang, C., Riley, J.F. et al. Elife (2021) 10. DOI 10.7554/eLife.70372 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4P8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7F69 1.5 Å, Crystal structure of WIPI2b in complex with ATG16L1
7XFR 1.76 Å, Crystal structure of WIPI2b in complex with the second site of ATG16L1

Browse structure collections

About this viewer

MolViewer shows 7MU2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.