7MZT: Borrelia burgdorferi BBK32-C

Borrelia burgdorferi BBK32-C in complex with an autolytic fragment of human C1r at 4.1A. Determined by X-ray diffraction at 4.07 Å resolution. Released 29 Sept 2021.

Method: X-ray diffraction
Resolution: 4.07 Å
Organisms: Homo sapiens, Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Chains: 3
Atoms: 4,120
Mol. weight: 63.48 kDa
Ligands: NAG
Released: 29 Sept 2021

Explore 7MZT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MZT contains 17 α-helices and 31 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	320-321	2	1
α-helix	322	1
β-strand	333-337	5	1
β-strand	342	1	2
β-strand	344-345	2	3
β-strand	350-351	2	3
β-strand	354-357	4	1
β-strand	370	1	3
β-strand	373	1	2
β-strand	385-389	5	4
β-strand	401-406	6	4
β-strand	411-413	3	5
β-strand	426-429	4	4
β-strand	435-437	3	4
β-strand	447-449	3	5
α-helix	450-451	2

Chain B: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	465	1	6
α-helix	467	1
β-strand	468-469	2	7
β-strand	479-481	3	8
β-strand	490-492	3	9
β-strand	496-500	5	9
α-helix	501-504	4
β-strand	519-521	3	8
α-helix	526-530	5
β-strand	535	1	8
β-strand	539-542	4	9
β-strand	558-562	5	9
α-helix	574-576	3
β-strand	577	1	7
α-helix	583-585	3
β-strand	590-595	6	7
β-strand	608-614	7	7
α-helix	615	1
α-helix	617-626	10
β-strand	637-642	6	7
β-strand	648	1	6
β-strand	657-661	5	7
β-strand	668-677	10	7
β-strand	683-689	7	7
α-helix	694-700	7

Chain I: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	213-242	30
α-helix	254-260	7
α-helix	261-263	3
α-helix	266-286	21
α-helix	293-316	24
α-helix	322-325	4
α-helix	332-339	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C1r subcomponent heavy chain	A	protein	164	Homo sapiens	P00736 (AlphaFold model)
Complement C1r subcomponent light chain	B	protein	242	Homo sapiens	P00736 (AlphaFold model)
Fibronectin-binding protein BBK32	I	protein	148	Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)	O50835 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7MZT_1 Complement C1r subcomponent heavy chain (chains A)
LRYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQ
DDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGS
RESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQR

Sequence of entity 2 (B), FASTA

>7MZT_2 Complement C1r subcomponent light chain (chains B)
IIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGH
TNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDT
FYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHP
SLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEE
ED

Sequence of entity 3 (I), FASTA

>7MZT_3 Fibronectin-binding protein BBK32 (chains I)
GSTGSSNRYQSYLEGVKYNVDSAIQTITKIYNTYTLFSTKLTQMYSTRLDNFAKAKAKEE
AAKFTKEDLEKNFKTLLNYIQVSVKTAANFVYINDTHAKRKLENIEAEIKTLIAKIKEQS
NLYEAYKAIVTSILLMRDSLKEVQGIID

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

A Structural Basis for Inhibition of the Complement Initiator Protease C1r by Lyme Disease Spirochetes. Garrigues, R.J., Powell-Pierce, A.D., Hammel, M. et al. J Immunol (2021) 207:2856-2867. DOI 10.4049/jimmunol.2100815 · PubMed

Other PDB entries of the same protein (UniProt P00736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6F1D 1.95 Å, CUB2 domain of C1r
2QY0 2.6 Å, Active dimeric structure of the catalytic domain of C1r reveals enzyme-product like…
1MD8 2.8 Å, Monomeric structure of the active catalytic domain of complement protease C1r
1GPZ 2.9 Å, The crystal structure of the zymogen catalytic domain of complement protease C1R
9EKE 3.1 Å, Structure of a C1r Zymogen Fragment Bound to SALO, Y51F Mutant
1MD7 3.2 Å, Monomeric structure of the zymogen of complement protease C1r
9EKD 3.28 Å, Structure of a C1r Zymogen Fragment Bound to SALO
6F1C 4.2 Å, C1rC1s complex
6F1H 4.5 Å, C1rC1s complex
6F39 5.8 Å, C1r homodimer CUB1-EGF-CUB2
1APQ Structure of the egf-like module of human C1R, NMR, 19 structures

Browse structure collections

About this viewer

MolViewer shows 7MZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.